¡Bienvenido a Santa Cruz Biotechnology!

MPST Anticuerpo(H-49): sc-292174

 |  Ficha Técnica

(Basado en el análisis de datos)

  • MPST Antibody (H-49) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 117-165 mapping within an internal region of MPST of human origin
  • recommended for detection of MPST of human, mouse and, to a lesser extent, rat origin by WB, IP, IF and ELISA; also reactive with additional species, including equine
 
Secuencia completa de la proteína para MPST con inmunógeno inidcado:
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH

Ver tambiénMPST Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MPST Antibody (H-49) sc-292174 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano MPST 4357 22q12.3 NM_001013436, NM_001130517, NM_021126 P25325
602496
Ratón Mpst 246221 15 E1 NM_001162492, NM_001162493, NM_138670 Q99J99
No Disponible
 


MPST (mercaptopyruvate sulfurtransferase), also known as MST or TST2, is a 297 amino acid protein that localizes to the cytoplasm and contains two rhodanese domains. Existing as a monomer or as a dilsulfide-linked homodimer, MPST functions to catalyze the transfer of a sulfur ion to select thiol compounds, such as cyanide, and is thought to be involved in cyanide detoxification and cysteine degradation. MPST deficiency may be associated with the pathogenesis of the rare disorder mercaptolactate-cysteine disulfiduria (MCDU). The gene encoding MPST maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.

MPST Antibody (H-49) Data
Haga click en la imágen para agrandarla
MPST (H-49): sc-292174. Western blot analysis of MPST expression in HEK293 (A) and HeLa (B) whole cell lysates.
Descargar