¡Bienvenido a Santa Cruz Biotechnology!

Urm1 Anticuerpo(H-78): sc-292073

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Urm1 Antibody (H-78) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 24-101 mapping at the C-terminus of Urm1 of human origin
  • recommended for detection of Urm1 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
 
Secuencia completa de la proteína para Urm1 con inmunógeno inidcado:
MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

Ver tambiénUrm AntibodiesincluyebdoUrmyUrm1.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Urm1 Antibody (H-78) sc-292073 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano URM1 81605 9q33.3 NM_001135947, NM_030914 Q9BTM9
n/a
Ratón Urm1 68205 2 B NM_026615 Q9D2P4
No Disponible
 


Ubiquitin (Ub) is among the most phylogenetically conserved proteins known. The primary function of this small, 76 amino acid protein is to clear abnormal, foreign and improperly folded proteins by targeting them for degradation by the 26S proteosome. Many ubiquitin-like proteins function as post-translational protein modifiers, such as members of the SUMO protein family, however some ubiquitin-like proteins regulate protein-protein interactions and cell cycle events, thereby functioning outside of the traditional ubiquitination pathway. Urm1 (Ubiquitin-related modifier 1 homolog) is a 101 amino acid protein that primarily functions in the post-translational modification of proteins by way of the urmylation pathway. In studies with Saccharomyces cerevisiae, it has been found that Urm1 covalently binds to its E1 activating enzyme, Uba4p, to conjugate alkyl hydroperoxide reductase (Ahp1). It is hypothesized that this complex may then play a role in the oxidative-stress response in mammals.