¡Bienvenido a Santa Cruz Biotechnology!

HP1 Anticuerpo(FL-191): sc-28735

 |  Ficha Técnica

(Basado en el análisis de datos)

  • HP1 Antibody (FL-191) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-191 representing full length HP1α of human origin
  • recommended for detection of HP1α, HP1β and HP1γ of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
  • See 3 citations for HP1 Anticuerpo (FL-191)
 
Secuencia completa de la proteína para HP1 con inmunógeno inidcado:
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAK

Ver tambiénHP1 AntibodiesincluyebdoHP1, HP1 alpha, HP1 betayHP1 gamma.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HP1 Antibody (FL-191) sc-28735 200 µg/ml $279
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
K-562 Whole Cell Lysate sc-2203 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
HP1α (h): 293 Lysate sc-110608 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano CBX5 23468 12q13.13 NM_012117 P45973
604478
Ratón Cbx5 12419 15 F3 Q61686
No Disponible
 


Chromatin assembly factor-1 (CAF-1) is a multisubunit protein complex that comprises three polypeptide subunits known as p150, p60 and p48. CAF-1 is a nucleosome assembly factor that deposits newly synthesized and acetylated Histones H3/H4 into nascent chromatin during DNA replication. The p150 subunit of CAF-1 also supports the maintenance of heterochromatin, which requires the synthesis of both new histones and heterochromatin proteins and their orderly assembly during DNA replication. Heterochromatin is characterized as densely coiled chromatin that generally replicates late during S phase, has a low gene density, and contains large blocks of repetitive DNA that is relatively inaccessible to DNA-modifying reagents. In late S phase, p150 directly associates with heterochromatin associated proteins 1 (HP1), HP1?, HP1? and HP1?. As cells prepare for mitosis, CAF-1 p150 and some HP1 progressively dissociate from heterochromatin, coinciding with the phosphorylation of Histone H3. The HP1 proteins reassociate with chromatin at the end of mitosis, as Histone H3 is dephosphorylated.

HP1 Antibody (FL-191) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados HP1 (FL-191).


3 menciones totales
Cargando las citaciones
 
HP1 Antibody (FL-191) Data
Haga click en la imágen para agrandarla
HP1 (FL-191): sc-28735. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
HP1 (FL-191): sc-28735. Immunoperoxidase staining of formalin fixed, paraffin-embedded human breast cancer tissue showing nuclear staining of tumor cells (low and high magnification). Kindly provided by The Swedish Human Protein Atlas (HPA) program.
HP1 (FL-191): sc-28735. Western blot analysis of HP1α expression in non-transfected 293: sc-110760 (A), human HP1α transfected 293: sc-110608 (B) and K-562 (C) whole cell lysates.
HP1 (FL-191): sc-28735. Western blot analysis of HP1 expression in Jurkat nuclear extract.
Descargar