¡Bienvenido a Santa Cruz Biotechnology!

Prohibitin Anticuerpo(H-80): sc-28259

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Prohibitin Antibody (H-80) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 193-272 mapping at the C-terminus of Prohibitin of human origin
  • recommended for detection of Prohibitin of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 5 citations for Prohibitin Anticuerpo (H-80)
 
Secuencia completa de la proteína para Prohibitin con inmunógeno inidcado:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Ver tambiénProhibitin AntibodiesincluyebdoProhibitinyProhibitin 2.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Prohibitin Antibody (H-80) sc-28259 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Prohibitin siRNA (h) sc-37629 10 µM $258
Prohibitin siRNA (m) sc-37630 10 µM $258
Prohibitin (h)-PR sc-37629-PR 10 µM, 20 µl $23
Prohibitin (m)-PR sc-37630-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Prohibitin shRNA Plasmid (h) sc-37629-SH 20 µg $520
Prohibitin shRNA Plasmid (m) sc-37630-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Prohibitin shRNA (h) Lentiviral Particles sc-37629-V 200 µl $625
Prohibitin shRNA (m) Lentiviral Particles sc-37630-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
A-431 Whole Cell Lysate sc-2201 500 µg/200 µl $104
Ramos Cell Lysate sc-2216 500 µg/200 µl $104
F9 Cell Lysate sc-2245 500 µg/200 µl $104
mouse heart extract sc-2254 500 µg/200 µl $104
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
A-10 Cell Lysate sc-3806 500 µg/200 µl $104
RAW 264.7 Whole Cell Lysate sc-2211 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano PHB 5245 17q21.33 NM_002634 P35232
176705
Ratón Phb 18673 11 D P67778
No Disponible
 


Prohibitin is an evolutionarily conserved protein that has antiproliferative activity. The gene encoding human prohibitin maps to chromosome 17q21 and is ubiquitously expressed. Prohibitin is a post-synthetically modified protein that is localized in the inner membrane of mitochondria, where it regulates the cell cycle by blocking the transition between the G1 and S phases, and on the plasma membrane of B cells, where it mediates B cell maturation. Prohibitin mRNA and protein levels are high in G1, decline during the S phase, rise again in G2 and decline in M phase, which suggests that prohibitin controls the cell cycle by using both transcriptional and posttranslational mechanisms. Prohibitin is also a potential tumor suppressor protein that binds to retinoblastoma (Rb) and subsequently inhibits the activity of E2F family members in response to specific signaling cascades. Prohibitin 2 is a repressor of estrogen receptor activity, and is required for somatic and germline differentiation in the larval gonad during embryonic development. Mutations in the Prohibitin genes are correlated with breast cancer development and/or progressionin more than 80% of the cell lines analyzed.

Prohibitin Antibody (H-80) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados Prohibitin (H-80).


5 menciones totales
Cargando las citaciones
 
Prohibitin Antibody (H-80) Data
Haga click en la imágen para agrandarla
Prohibitin (H-80): sc-28259. Western blot analysis of Prohibitin expression in A-431 (A) and Ramos (B) whole cell lysates.
Prohibitin (H-80): sc-28259. Immunofluorescence staining of methanol-fixed A-431 cells showing cytoplasmic localization.
Descargar