¡Bienvenido a Santa Cruz Biotechnology!

MAP LC3β Anticuerpo(G-2): sc-271625

 |  Ficha Técnica

(Basado en el análisis de datos)

  • MAP LC3β Antibody (G-2) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-50 mapping at the N-terminus of MAP LC3β of human origin
  • recommended for detection of MAP LC3β , MAP LC3β2and, to a lesser extent, MAP LC3α of human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including canine, bovine and porcine
 
Secuencia completa de la proteína para MAP LC3β con inmunógeno inidcado:
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV

Ver tambiénMAP LC3 AntibodiesincluyebdoMAP LC3, MAP LC3γ, MAP LC3 alphayMAP LC3 beta.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MAP LC3β Antibody (G-2) sc-271625 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano MAP1LC3B 81631 16q24.2 NM_022818 Q9GZQ8
n/a
Humano MAP1LC3A 84557 20q11.22 NM_032514, NM_181509 NP_115903
601242
Ratón Map1lc3a 66734 2 H1 NM_025735 Q91VR7
No Disponible
 


Microtubule-associated proteins (MAPs) regulate microtubule stability and play critical roles in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. MAP-light chain 3 beta (MAP-LC3∫) and MAP-light chain 3 alpha (MAP-LC3å) are subunits of both MAP1A and MAP1B. MAP-LC3∫, a homolog of Apg8p, is essential for autophagy and associated to the autophagosome membranes after processing. Two forms of LC3∫, the cytosolic LC3-I and the membrane-bound LC3-II, are produced post-translationally. LC3-I is formed by the removal of the C-terminal 22 amino acids from newly synthesized LC3∫, followed by the conversion of a fraction of LC3-I into LC3-II. LC3 enhances fibronectin mRNA translation in ductus arteriosus cells through association with 60S ribosomes and binding to an AU-rich element in the 3’ untranslated region of fibronectin mRNA. This facilitates sorting of fibronectin mRNA onto rough endoplasmic reticulum and translation. MAP LC3∫ may also be involved in formation of autophagosomal vacuoles. It is expressed primarily in heart, testis, brain and skeletal muscle.

MAP LC3β Antibody (G-2) Data
Haga click en la imágen para agrandarla
MAP LC3β (G-2): sc-271625. Western blot analysis of MAP LC3β expression in IMR-32 whole cell lysate.
MAP LC3β (G-2): sc-271625. Western blot analysis of MAP LC3β expression in untreated (A) and AMPK Activator (sc-203819) treated (B) PC-3 whole cell lysates. Note upregulation of MAP LC3β expression in lane B.
MAP LC3b (G-2): sc-271625. Immunoperoxidase stain-ing of formalin fixed, paraffin-embedded human brain tissue showing cytoplasmic staining of neuronal and glial cells.
Descargar