¡Bienvenido a Santa Cruz Biotechnology!

Jun Anticuerpo(d-230): sc-25763

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Jun Antibody (d-230) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-230 of Jun of Drosophila melanogaster origin
  • recommended for detection of Jun of Drosophila origin by WB, IP, IF and ELISA
  • See 1 citations for Jun Anticuerpo (d-230)
 
Secuencia completa de la proteína para Jun con inmunógeno inidcado:
MKTPVSAAANLSIQNAGSSGATAIQIIPKTEPVGEEGPMSLDFQSPNLNTSTPNPNKRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTPQPGKVFPTKAGPVTVEQLDFGRGFEEALHNLHTNSQAFPSANSAANSAANNTTAAAMTAVNNGISGGTFTYTNMTEGFSVIKDEPVNQASSPTVNPIDMEAQEKIKLERKRQRNRVAASKCKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQ

Ver tambiénJun AntibodiesincluyebdoJun, c-Jun, Jun ByJun D.

También verJun Activators for functional analysis of cellular responses to Jun.


Información sobre pedidosMenciones del Producto
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Jun Antibody (d-230) sc-25763 200 µg/ml $279


Drosophila melanogaster is a proven and effective model for studying developmental and cellular processes common to higher eukaryotes. Approximately 13,600 genes have been elucidated from more than 120 megabases of euchromatin, and they are organized among the chromosomes 2, 3, 4, X and Y, with the Y chromosome being predominately heterochromatic (1). Drosophila genes can be categorized based on the type of protein they encode and are represented by six major classifications, which include intracellular signaling proteins, transmembrane proteins, RNA binding proteins, secreted factor≠s, transcription regulators (basic helix-loop-helix, homeodomain containing, zinc finger containing, and chromatin associated) or other functional proteins (2). Many of the genes expressed in Drosophila are structurally and functionally similar across species, as are the pathways involved in transducing intracellular signaling. Among these proteins, Jun is a transcription factor that participates in signaling pathways related to mammalian Ras, Raf, ERK cascades (3-6). Like members of the mammalian AP-1 class of transcription regulators, Drosophila Jun contains a DNA-binding domain consisting of a leucine zipper and an adjacent basic region (3-6).

Jun Antibody (d-230) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados Jun (d-230).


1 menciones totales
Cargando las citaciones
 
Jun Antibody (d-230) Data
Haga click en la imágen para agrandarla
Jun (d-230): sc-25763. Western blot analysis of Jun expression in Schneider's Drosophila line 2 whole cell lysate.
Descargar