¡Bienvenido a Santa Cruz Biotechnology!

BDNF Anticuerpo(H-117): sc-20981

 |  Ficha Técnica

(Basado en el análisis de datos)

  • BDNF Antibody (H-117) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 130-247 mapping at the C-terminus of BDNF of human origin
  • recommended for detection of BDNF of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • agarose conjugate for IP studies, sc-20981 AC, 500 µg/0.25 ml agarose
  • See 15 citations for BDNF Anticuerpo (H-117)
 
Secuencia completa de la proteína para BDNF con inmunógeno inidcado:
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Ver tambiénBDNF Antibodies.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
BDNF Antibody (H-117) sc-20981 200 µg/ml $279
BDNF Antibody (H-117) AC sc-20981 AC 500 µg/ml, 25% ag $366
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
BDNF siRNA (h) sc-42121 10 µM $258
BDNF siRNA (m) sc-42122 10 µM $258
BDNF (h)-PR sc-42121-PR 10 µM, 20 µl $23
BDNF (m)-PR sc-42122-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
BDNF shRNA Plasmid (h) sc-42121-SH 20 µg $520
BDNF shRNA Plasmid (m) sc-42122-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
BDNF shRNA (h) Lentiviral Particles sc-42121-V 200 µl $625
BDNF shRNA (m) Lentiviral Particles sc-42122-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SH-SY5Y Cell Lysate sc-3812 500 µg/200 µl $104
U-87 MG Cell Lysate sc-2411 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano BDNF 627 11p14.1 NM_001709, NM_170731, NM_170732, NM_170733, NM_170734, NM_170735 P23560
607499
Ratón Bdnf 12064 2 E3 P21237
No Disponible
 


Neurotrophins function to regulate naturally occurring cell death of neurons during development. The prototype neurotrophin is nerve growth factor (NGF), originally discovered in the 1950s as a soluble peptide promoting the survival of, and neurite outgrowth from, sympathetic ganglia. Three additional structurally homologous neurotrophic factors have been identified. These include brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3) and neurotrophin-4 (NT-4) (also designated NT-5). These various neurotrophins stimulate the in vitro survival of distinct, but partially overlapping, populations of neurons. The cell surface receptors through which neurotrophins mediate their activity have been identified. For instance, the Trk A receptor is the preferential receptor for NGF, but also binds NT-3 and NT-4. The Trk B receptor binds both BDNF and NT-4 equally well, and binds NT-3 to a lesser extent, while the Trk C receptor only binds NT-3.

BDNF Antibody (H-117) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados BDNF (H-117).


14 menciones totales
Cargando las citaciones
 
BDNF Antibody (H-117) Data
Haga click en la imágen para agrandarla
BDNF (H-117): sc-20981. Western blot analysis of BDNF expression in SH-SY5Y (A) and U-87 MG (B) whole cell lysates.
BDNF (H-117): sc-20981. Immunoperoxidase staining of formalin fixed, paraffin-embedded human skeletal muscle tissue showing cytoplasmic staining of myocytes at low (A) and high (B) magnification. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
BDNF (H-117): sc-20981. Western blot analysis of BDNF expression in U-87 MG whole cell lysate.
Descargar