¡Bienvenido a Santa Cruz Biotechnology!

GNMT Anticuerpo(A-4): sc-166834

 |  Ficha Técnica

(Basado en el análisis de datos)

  • GNMT Antibody (A-4) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 71-295 mapping at the C-terminus of GNMT of human origin
  • recommended for detection of glycine N-methyltransferase of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para GNMT con inmunógeno inidcado:
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD

Ver tambiénGNMT Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GNMT Antibody (A-4) sc-166834 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GNMT siRNA (h) sc-62391 10 µM $258
GNMT siRNA (m) sc-62392 10 µM $258
GNMT (h)-PR sc-62391-PR 10 µM, 20 µl $23
GNMT (m)-PR sc-62392-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GNMT shRNA Plasmid (h) sc-62391-SH 20 µg $520
GNMT shRNA Plasmid (m) sc-62392-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GNMT shRNA (h) Lentiviral Particles sc-62391-V 200 µl $625
GNMT shRNA (m) Lentiviral Particles sc-62392-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
GNMT (h): 293T Lysate sc-115155 100 µg/200 µl $205
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
GNMT (h3): 293T Lysate sc-170814 100 µg/200 µl $205
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano GNMT 27232 6p21.1 Q14749
606664
Ratón Gnmt 14711 17 C Q9QXF8
No Disponible
 


Glycine N-methyltransferase (GNMT) is a 295 amino acid protein that catalyzes the methylation of glycine by using S-adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). This process indicates that GNMT probably plays a crucial role in the regulation of tissue concentration of AdoMet and in the metabolism of methionine. Originally identified as a methyl donor, AdoMet is now considered a key metabolite that regulates hepatocyte growth, death and differentiation. Biosynthesis of AdoMet occurs in all mammalian cells as the first step in methionine catabolism in a reaction catalyzed by methionine adenosyltransferase (MAT). Decreased hepatic AdoMet biosynthesis is a consequence of all forms of chronic liver injury. In chronic liver AdoMet deficiency, the liver is predisposed to further injury and can develop spontaneous steatohepatitis and hepatocellular carcinoma. However, impaired AdoMet metabolism, which occurs in patients with mutations of GNMT, can also lead to liver injury.

GNMT Antibody (A-4) Data
Haga click en la imágen para agrandarla
GNMT (A-4): sc-166834. Western blot analysis of GNMT expression in non-transfected: sc-117752 (A) and human GNMT transfected: sc-170814 (B) 293T whole cell lysates.
GNMT (A-4): sc-166834. Immunofluorescence staining of methanol-fixed untransfected (A) and human GNMT transfected HEK 293T cells (B).
GNMT (A-4): sc-166834. Western blot analysis of GNMT expression in non-transfected: sc-110760 (A) and human GNMT transfected: sc-158555 (B) 293 whole cell lysates.
GNMT (A-4): sc-166834. Immunofluorescence staining of methanol-fixed non-transfected (A) and human GNMT transfected (B) 293T cells.
GNMT (A-4): sc-166834. Immunoperoxidase staining of formalin fixed, paraffin-embedded human pancreas tissue showing cytoplasmic and nuclear staining of glandular cells.
Descargar