¡Bienvenido a Santa Cruz Biotechnology!

cystatin B Anticuerpo(F-5): sc-166561

 |  Ficha Técnica

(Basado en el análisis de datos)

  • cystatin B Antibody (F-5) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 51-98 mapping at the C-terminus of cystatin B of human origin
  • recommended for detection of cystatin B of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para cystatin B con inmunógeno inidcado:
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Ver tambiénCystatin AntibodiesincluyebdoCystatin, cystatin 10, cystatin 12, cystatin 13, cystatin A, cystatin B, cystatin C, cystatin D, cystatin E/M, cystatin F, cystatin S, cystatin SA, cystatin SN, cystatin 8, cystatin 9ycystatin 11.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
cystatin B Antibody (F-5) sc-166561 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
cystatin B siRNA (h) sc-44431 10 µM $258
cystatin B (h)-PR sc-44431-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
cystatin B shRNA Plasmid (h) sc-44431-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
cystatin B shRNA (h) Lentiviral Particles sc-44431-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
cystatin B (h): 293 Lysate sc-110475 100 µg/200 µl $205
cystatin B (h2): 293 Lysate sc-112337 100 µg/200 µl $205
T98G Cell Lysate sc-2294 500 µg/200 µl $104
U-87 MG Cell Lysate sc-2411 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano CSTB 1476 21q22.3 P04080
601145
 


Cystatin A (also designated STF1, STFA, stefin A or cystatin AS) and Cystatin B (also designated PME, CST6, STFB, CPI-B, stefin B and liver thiol proteinase inhibitor) are thiol protease inhibitors that form complexes with papain and the cathepsins B, H, and L. Cystatin A, a cytoplasmic protein, is one of the precursor proteins of the cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Cystatin B protects against intracellular proteases leaking out of lysosomes and is primarily expressed in heart, liver and kidney.

cystatin B Antibody (F-5) Data
Haga click en la imágen para agrandarla
cystatin B (F-5): sc-166561. Western blot analysis of cystatin B expression in non-transfected 293: sc-110760 (A), human cystatin B transfected 293: sc-110475 (B) and U-87 MG (C) whole cell lysates.
cystatin B (F-5): sc-166561. Immunoperoxidase staining of formalin fixed, paraffin-embedded human esophagus tissue showing cytoplasmic and nuclear staining of squamous epithelial cells.
Descargar