¡Bienvenido a Santa Cruz Biotechnology!

SLUG Anticuerpo(A-7): sc-166476

 |  Ficha Técnica

(Basado en el análisis de datos)

  • SLUG Antibody (A-7) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 21-160 of SLUG of human origin
  • recommended for detection of SLUG of human origin by WB, IP, IF, IHC(P) and ELISA
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-166476 X, 200 µg/0.1 ml
 
Secuencia completa de la proteína para SLUG con inmunógeno inidcado:
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

Ver tambiénSLUG Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SLUG Antibody (A-7) sc-166476 200 µg/ml $279
SLUG Antibody (A-7) X sc-166476 X 200 µg/0.1 ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SLUG siRNA (h) sc-38393 10 µM $258
SLUG siRNA (m) sc-38394 10 µM $258
SLUG (h)-PR sc-38393-PR 10 µM, 20 µl $23
SLUG (m)-PR sc-38394-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SLUG shRNA Plasmid (h) sc-38393-SH 20 µg $520
SLUG shRNA Plasmid (m) sc-38394-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
SLUG shRNA (h) Lentiviral Particles sc-38393-V 200 µl $625
SLUG shRNA (m) Lentiviral Particles sc-38394-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
SLUG (h2): 293 Lysate sc-111905 100 µg/200 µl $205
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano SNAI2 6591 8q11.21 O43623
608890
Ratón Snai2 20583 16 A1 P97469
No Disponible
 


The SNAIL family of developmental regulatory proteins is a group of widely conserved zinc-finger proteins that regulate transcription and include the mammalian proteins SLUG, SNAI 1 (the human homolog of Drosophila SNAIL) and Smuc. SNAI 1 and SLUG are expressed in placenta and in adult heart, liver, and skeletal muscle. SNAI 1, and the corresponding mouse homolog Sna, each contain three classic zinc fingers and one atypical zinc finger, while SLUG contains five zinc finger regions and a transcriptional repression domain at the amino terminus, which enables SLUG to act as a negative regulator of gene expression. SLUG is implicated in the generation and migration of neural crest cells in human embryos and also contributes to limb bud development. In addition, SLUG also constitutes a cellular anti-apoptotic transcription factor that effectively prevents apoptosis in murine pro-B cells deprived of IL-3. The SNAIL-related gene from murine skeletal muscle cells, Smuc, is highly expressed in skeletal muscle and thymus and can, likewise, repress gene transcription. Smuc preferentially associates with CAGGTG and CACCTG E-box motifs (CANNTG) on DNA and involves the five putative DNA-binding zinc finger domains at the C-terminal region of Smuc.

SLUG Antibody (A-7) Data
Haga click en la imágen para agrandarla
SLUG (A-7): sc-166476. Western blot analysis of SLUG expression in non-transfected: sc-110760 (A) and human SLUG transfected: sc-111905 (B) 293 whole cell lysates.
SLUG (A-7): sc-166476. Western blot analysis of SLUG expression in non-transfected: sc-110760 (A) and human SLUG transfected: sc-111905 (B) 293 whole cell lysates.
SLUG (A-7): sc-166476. Immunoperoxidase staining of formalin fixed, paraffin-embedded human breast tissue showing nuclear staining of myoepithelial cells.
Descargar