¡Bienvenido a Santa Cruz Biotechnology!

CD81 Anticuerpo(D-4): sc-166028

 |  Ficha Técnica

(Basado en el análisis de datos)

  • CD81 Antibody (D-4) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 90-210 of CD81 of human origin
  • recommended for detection of CD81 of human origin by WB, IP, IF, IHC(P) and ELISA
 
Secuencia completa de la proteína para CD81 con inmunógeno inidcado:
MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Ver tambiénCD81 Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
CD81 Antibody (D-4) sc-166028 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
CD81 siRNA (h) sc-35030 10 µM $258
CD81 siRNA (m) sc-37251 10 µM $258
CD81 (h)-PR sc-35030-PR 10 µM, 20 µl $23
CD81 (m)-PR sc-37251-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
CD81 shRNA Plasmid (h) sc-35030-SH 20 µg $520
CD81 shRNA Plasmid (m) sc-37251-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
CD81 shRNA (h) Lentiviral Particles sc-35030-V 200 µl $625
CD81 shRNA (m) Lentiviral Particles sc-37251-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Ramos Cell Lysate sc-2216 500 µg/200 µl $104
MM-142 Cell Lysate sc-2246 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano CD81 975 11p15.5 P60033
186845
Ratón Cd81 12520 7 F5 P35762
No Disponible
 


CD81, also called TAPA-1, is a type III transmembrane protein that is broadly expressed on cells of hematopoietic, neuroectodermal and mesenchymal origin. CD81 is believed to be involved in both cell growth and signal transduction. It can be present as a multimolecular complex in association with CD37 and/or CD53, or on the surface of B cells in association with CD19, CD21 and/or MHC class II antigens.

CD81 Antibody (D-4) Data
Haga click en la imágen para agrandarla
CD81 (D-4): sc-166028. Western blot analysis of CD81 expression in Ramos whole cell lysate.
CD81 (D-4): sc-166028. Immunoperoxidase staining of formalin fixed, paraffin-embedded human tonsil tissue showing cytoplasmic and membrane staining of cells in germinal and non-germinal centers.
CD81 (D-4): sc-166028. Western blot analysis of CD81 expression in Ramos (A) and Jurkat (B) whole cell lysates.
Descargar