¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Intermediarios de Señal » MetAP Anticuerpos » MetAP-1 Antibody (H-140): sc-134731

MetAP-1 Anticuerpo(H-140): sc-134731

 |  Ficha Técnica

(Basado en el análisis de datos)
  • MetAP-1 Antibody (H-140) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-140 mapping at the N-terminus of MetAP-1 of human origin
  • recommended for detection of MetAP-1 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including bovine, porcine and avian
 
Secuencia completa de la proteína para MetAP-1 con inmunógeno inidcado:
MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKLLSSEDIEGMLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF

Ver tambiénMetAP AntibodiesincluyebdoMetAP, MetAP-1yMetAP-2.

También verMetAP Inhibitors for functional analysis of cellular responses to MetAP.


Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MetAP-1 Antibody (H-140) sc-134731 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MetAP-1 siRNA (h) sc-61022 10 µM $258
MetAP-1 siRNA (m) sc-61023 10 µM $258
MetAP-1 (h)-PR sc-61022-PR 10 µM, 20 µl $23
MetAP-1 (m)-PR sc-61023-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MetAP-1 shRNA Plasmid (h) sc-61022-SH 20 µg $520
MetAP-1 shRNA Plasmid (m) sc-61023-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
MetAP-1 shRNA (h) Lentiviral Particles sc-61022-V 200 µl $625
MetAP-1 shRNA (m) Lentiviral Particles sc-61023-V 200 µl $625
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano METAP1 23173 4q23 P53582
 610151
Ratón Metap1 75624 3 G3 Q8BP48
 No Disponible
 

Methionine aminopeptidases (MetAP), also designated peptidase M proteins, are members of the M24 family of proteins. MetAP proetins remove the amino-terminal methionine residue from nascent polypeptides. MetAP-1 is a 394-amino acid protein that is expressed at low levels in all tissues, but is highly expressed in skeletal muscles. The active site of MetAP-1 contains two adjacent divalent metal ions connected by a water molecule or hydroxide ion. The control of cell proliferation in mammalian cells is directly linked and strictly dependent on the evolutionarily highly conserved mechanism that MetAP-1 employs. Eukaryotes contain both MetAP-1 and MetAP-2, whereas prokaryotes possess only the MetAP-1 enzyme. Pyridine-2-carboxylic acid thiazol-2-ylamide (PCAT) forms a scaffold that inhibits the action of MetAP-1, while 1,2,4-triazol is a non-peptide inhibitor of MetAP-1 binding to the active site with the N1 and N2 atoms of the triazole moiety complexing two divalent ions.