¡Bienvenido a Santa Cruz Biotechnology!

Glycodelin Anticuerpo(FL-180): sc-134479

 |  Ficha Técnica

(Basado en el análisis de datos)

  • Glycodelin Antibody (FL-180) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-180 representing full length Glycodelin of human origin
  • recommended for detection of Glycodelin of human origin by WB, IP, IF and ELISA
 
Secuencia completa de la proteína para Glycodelin con inmunógeno inidcado:
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCR

Ver tambiénGlycodelin Antibodies.

Información sobre pedidosInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
Glycodelin Antibody (FL-180) sc-134479 200 µg/ml $279
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano PAEP 5047 9q34.3 P09466
173310
 


Glycodelin (also designated GD, placental protein 14, PP14, progesterone-associated endometrial protein, progestagen-associated endometrial protein, pregnancy-associated endometrial alpha-2 globulin, PAEG or PEG) is a glycoprotein with structural homology to beta-lactoglobulins. Glycodelin is synthesized by the secretory endometrium and decidua during embryo implantation and in the first few weeks of pregnancy. It is expressed in steroid responsive tissues of the female reproductive tract and in the paranucleolar vacuole, which is characteristically present in lobular breast cancer cells (5-7). Glycodelin expression in breast cancer cells is accompanied by the acquisition of a phenotype of organized glandular epithelium (7).