¡Bienvenido a Santa Cruz Biotechnology!
SCBT Home
Página Principal » Supresores Tumorales/Apoptosis » AIF Anticuerpos » AIF Antibody (E-1): sc-13116

AIF Anticuerpo(E-1): sc-13116

 |  Ficha Técnica

(Basado en el análisis de datos)

  • AIF Antibody (E-1) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-300 of AIF of human origin
  • recommended for detection of AIF of mouse, rat and human origin by WB, IP, IF, IHC(P), FCM and ELISA
  • agarose conjugate for IP studies, sc-13116 AC, 500 µg/0.25 ml agarose
  • HRP conjugate, sc-13116 HRP, 200 µg/ml
  • fluorescein (sc-13116 FITC) and phycoerythrin (sc-13116 PE) conjugates for intracellular FCM, 100 tests
  • See 59 citations for AIF Anticuerpo (E-1)
 
Secuencia completa de la proteína para AIF con inmunógeno inidcado:
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Ver tambiénAIF AntibodiesincluyebdoAIFyAIFL.

Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   FCM   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
AIF Antibody (E-1) sc-13116 200 µg/ml $279
AIF Antibody (E-1) AC sc-13116 AC 500 µg/ml, 25% ag $366
AIF Antibody (E-1) FITC sc-13116 FITC 100 tests in 2 ml $292
AIF Antibody (E-1) HRP sc-13116 HRP 200 µg/ml $279
AIF Antibody (E-1) PE sc-13116 PE 100 tests in 2 ml $303
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
AIF siRNA (h) sc-29193 10 µM $258
AIF siRNA (m) sc-29194 10 µM $258
AIF siRNA (h2) sc-44243 10 µM $258
AIF (h)-PR sc-29193-PR 10 µM, 20 µl $23
AIF (m)-PR sc-29194-PR 10 µM, 20 µl $23
AIF (h2)-PR sc-44243-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
AIF shRNA Plasmid (h) sc-29193-SH 20 µg $520
AIF shRNA Plasmid (m) sc-29194-SH 20 µg $520
AIF shRNA Plasmid (h2) sc-44243-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
AIF shRNA (h) Lentiviral Particles sc-29193-V 200 µl $625
AIF shRNA (m) Lentiviral Particles sc-29194-V 200 µl $625
AIF shRNA (h2) Lentiviral Particles sc-44243-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
AIF (m): 293T Lysate sc-118296 100 µg/200 µl $205
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
CCRF-CEM Cell Lysate sc-2225 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
MOLT-4 Cell Lysate sc-2233 500 µg/200 µl $104
CTLL-2 Cell Lysate sc-2242 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano AIFM1 9131 Xq25 NM_004208, NM_145812, NM_145813 O95831
 300169
Ratón Aifm1 26926 X A4 Q9Z0X1
 No Disponible
 

A key event in the apoptotic process is the opening of the mitochondrial permeability transition pore, an event that is regulated by Bcl-2 family proteins, resulting in the release of several proteins from the mitochondrial intermembrane space. Several of these proteins participate in apoptosis, including cytochrome c, procaspases 2, 3, and 9, and AIF (apoptosis-inducing factor). AIF has been shown to cause DNA fragmentation and chromatin condensation and to induce the release of cytochrome c and caspase-9 from mitochondria. Bcl-2 overexpression has been shown to prevent the release of AIF from mitochondria, but not to block its apoptogenic activity.

AIF Antibody (E-1) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados AIF (E-1).


58 menciones totales
Cargando las citaciones
 
AIF Antibody (E-1) Data
Haga click en la imágen para agrandarla
sc-13116
AIF (E-1): sc-13116. Western blot analysis of AIF expression in Jurkat whole cell lysate.
sc-13116
AIF (E-1) PE: sc-13116 PE. Intracellular FCM analysis of fixed and permeabilized Jurkat cells. Black line histogram represents the isotype control, normal mouse IgG2b: sc-2868.
sc-13116
AIF (E-1): sc-13116. Western blot analysis of AIF expression in non-transfected 293T: sc-117752 (A), mouse AIF transfected 293T: sc-118296 (B) and CTLL-2 (C) whole cell lysates.
sc-13116
AIF (E-1): sc-13116. Western blot analysis of AIF expression in non-transfected 293T: sc-117752 (A), human AIF transfected 293T: sc-111943 (B) and HeLa (C) whole cell lysates.
sc-13116
AIF (E-1): sc-13116. Immunoperoxidase staining of formalin fixed, paraffin-embedded human testis tissue showing cytoplasmic staining of Leydig cells and cells in seminiferous ducts.
Descargar
Ficha técnica
Conseguir Adobe Acrobat Reader