¡Bienvenido a Santa Cruz Biotechnology!

UBC9 Anticuerpo(H-81): sc-10759

 |  Ficha Técnica

(Basado en el análisis de datos)

  • UBC9 Antibody (H-81) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-81 of UBC9 of human origin
  • recommended for detection of UBC9 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 23 citations for UBC9 Anticuerpo (H-81)
 
Secuencia completa de la proteína para UBC9 con inmunógeno inidcado:
MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS

Ver tambiénUBC AntibodiesincluyebdoUBC, Ubc2, UBE2NL, UBC8, UBC9, UBC12yUBC13.

También verUBC Inhibitors for functional analysis of cellular responses to UBC.


Información sobre pedidosMenciones del ProductoInformación del gen
Productos Complementarios Recomendados:
(Haga click en el botón de la aplicación que desee)
WB   IP   IF   IHC(P)   siRNA  
Indique que divisas

 Información sobre pedidos
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
UBC9 Antibody (H-81) sc-10759 200 µg/ml $279
 Silenciadores de Genes siRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
UBC9 siRNA (h) sc-36773 10 µM $258
UBC9 siRNA (m) sc-36774 10 µM $258
UBC9 (h)-PR sc-36773-PR 10 µM, 20 µl $23
UBC9 (m)-PR sc-36774-PR 10 µM, 20 µl $23
 Plásmidos shRNA (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
UBC9 shRNA Plasmid (h) sc-36773-SH 20 µg $520
UBC9 shRNA Plasmid (m) sc-36774-SH 20 µg $520
 shRNA partículas antivirales (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
UBC9 shRNA (h) Lentiviral Particles sc-36773-V 200 µl $625
UBC9 shRNA (m) Lentiviral Particles sc-36774-V 200 µl $625
 Lisado de células para control positivo de WB (Haga click en el nombre del producto para obtener más información)
Nombre del productoNúmero de catálogoUnidadPrecioCantidadAñadir 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
U-937 Cell Lysate sc-2239 500 µg/200 µl $104
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
HL-60 Whole Cell Lysate sc-2209 500 µg/200 µl $104
 
Especies Nombre del Gen Gene ID Ubicación en el cromosoma Numero de Acceso de Isoforma (ARNm) Número de Acceso de la Proteína Número OMIM™:
Humano UBE2I 7329 16p13.3 NM_003345, NM_194259, NM_194260, NM_194261 P63279
601661
Ratón Ube2i 22196 17 A3.3 P63280
No Disponible
 


UBC9 is a component of the ubiquitin-mediated proteolytic pathway, which targets proteins for degradation by the 26S proteasome, mediates endocytosis and directs protein subcellular localization (1,2). Ub and Ub-like molecules are systematically transferred from E2 conjugating enzymes to the targeted substrate by way of an E3 ubiquitin ligase (3). UBC9 functions as an E2 ubiquitin conjugating enzyme that preferentially associates with the ubiquitin homolog designated SUMO-1 or sentrin, a component of the sentrinization complex (4). Characteristic of the E2 family members, UBC9 contains a conserved cysteine residue that is required for the thio ester formation between Ub-like proteins and the E2 member, and it shares a conserved UBC domain (5). Substrates for UBC9 include transcription factors E12 and E47 and mitotic regulators RanBP2 and RanGAP1, which indicates that UBC9 may regulate various cellular processes including cell cycle progression and differentiation (6,7).

UBC9 Antibody (H-81) Menciones del Producto
Vea como otros han usado anticuerpos %catalog_number% y/o anticuerpos conjugados UBC9 (H-81).


23 menciones totales
Cargando las citaciones
 
UBC9 Antibody (H-81) Data
Haga click en la imágen para agrandarla
UBC9 (H-81): sc-10759. Western blot analysis of UBC9 expression in HeLa nuclear extract.
UBC9 (H-81): sc-10759. Immunoperoxidase staining of formalin fixed, paraffin-embedded human malignant lymphoma tissue showing nuclear staining of tumor cells at low (A) and high (B) magnification. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
UBC9 (H-81): sc-10759. Western blot analysis of UBC9 expression in HeLa whole cell lysate.
UBC9 (H-81): sc-10759. Western blot analysis of UBC9 expression in Jurkat whole cell lysate.
UBC9 (H-81): sc-10759. Western blot analysis of UBC9 expression in HeLa whole cell lysate.
Descargar