Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Membrane Receptors » AdipoR Antibodies » AdipoR2 Antibody (H-44): sc-99184

AdipoR2 Antibody (H-44): sc-99184

 |  Datasheet

(Based on data analysis)
  • AdipoR2 Antibody (H-44) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 287-330 mapping near the C-terminus of AdipoR2 of human origin
  • recommended for detection of AdipoR2 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
 
Full-length AdipoR2 protein sequence with immunogen highlighted:
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL

See additional AdipoR Antibodies including AdipoR, AdipoR1 and AdipoR2.

Ordering Information
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
AdipoR2 Antibody (H-44) sc-99184 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AdipoR2 siRNA (h) sc-60125 10 µM $258
AdipoR2 siRNA (m) sc-60126 10 µM $258
AdipoR2 siRNA (r) sc-156025 10 µM $258
AdipoR2 (h)-PR sc-60125-PR 10 µM, 20 µl $23
AdipoR2 (m)-PR sc-60126-PR 10 µM, 20 µl $23
AdipoR2 (r)-PR sc-156025-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AdipoR2 shRNA Plasmid (h) sc-60125-SH 20 µg $520
AdipoR2 shRNA Plasmid (m) sc-60126-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AdipoR2 shRNA (h) Lentiviral Particles sc-60125-V 200 µl $625
AdipoR2 shRNA (m) Lentiviral Particles sc-60126-V 200 µl $625

Adiponectin is a circulating hormone secreted by adipocytes that improves the metabolism of glucose and lipids, and is expressed at low levels in those with obesity and diabetes. Adiponectin receptors AdipoR1 and AdipoR2, also designated progestin and adipoQ receptor family members I and II, respectively, regulate fatty acid oxidation and the uptake of glucose by adiponectin. Each receptor activates a unique set of signaling molecules including AMPK, p38 MAPK and PPARå. AdipoR1 has a high-affinity for globular adiponectin and low-affinity for full-length adiponectin, while AdipoR2 has an intermediate affinity for both forms. AdipoR1 and AdipoR2 are mainly expressed in liver and muscle. Adiponectin, AdipoR1 and AdipoR2 are all associated with body composition, insulin sensitivity, and metabolic parameters. Physical training increases circulating adiponectin and mRNA expression of AdipoR1 and AdipoR2 in muscle, which may mediate the improvement of insulin resistance and the metabolic syndrome in response to exercise.