Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Synthesis and Degradation » GD GM Synthase Antibodies » GD3 Synthase Antibody (H-76): sc-99093

GD3 Synthase Antibody (H-76): sc-99093

 |  Datasheet

(Based on data analysis)

  • GD3 Synthase Antibody (H-76) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 65-140 mapping near the N-terminus of GD3 Synthase of human origin
  • recommended for detection of GD3 Synthase of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine and bovine
 
Full-length GD3 Synthase protein sequence with immunogen highlighted:
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

See additional GD GM Synthase Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
GD3 Synthase Antibody (H-76) sc-99093 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ST8SIA1 6489 12p12.1 Q92185
 601123
 

GD3 Synthase (GD3S, SIAT8, ST8SiaI, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1) is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. GD3 Synthase is found in the Golgi apparatus and is a member of glycosyltransferase family 29. GD3 synthase can down-regulate MMP-9 promoter activity in response to TNF-alpha by association with NF-kappaB and activation protein-1 (AP-1) sites in the MMP-9 promoter. GD3 Synthase has an apoptotic effect on ECV304 cells through downregulation of Bcl-2 expression via dephosphorylation of AKT and CREB.
GD3 Synthase Antibody (H-76) Data
Click on image to enlarge
sc-99093
GD3 Synthase (H-76): sc-99093. Western blot analysis of GD3 Synthase expression in non-transfected: sc-117752 (A) and mouse GD3 Synthase transfected: sc-120460 (B) 293T whole cell lysates.
sc-99093
GD3 Synthase (H-76): sc-99093. Immunoperoxidase staining of formalin fixed, paraffin-embedded human gall bladder tissue showing cytoplasmic and membrane staining of glandular cells.
Download
Datasheets
Get Adobe Acrobat Reader