Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transport and Trafficking » NRBF2 Antibodies » NRBF2 Antibody (H-93) : sc-98419

NRBF2 Antibody (H-93) : sc-98419

 |  Datasheet

(Based on data analysis)

  • NRBF2 Antibody (H-93) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-93 mapping at the N-terminus of NRBF2 of human origin
  • recommended for detection of NRBF2 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including canine, bovine, porcine and avian
 
Full-length NRBF2 protein sequence with immunogen highlighted:
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

See additional NRBF2 Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
NRBF2 Antibody (H-93) sc-98419 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
NRBF2 siRNA (h) sc-90694 10 µM $258
NRBF2 siRNA (m) sc-150062 10 µM $258
NRBF2 (h)-PR sc-90694-PR 10 µM, 20 µl $23
NRBF2 (m)-PR sc-150062-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
NRBF2 shRNA Plasmid (h) sc-90694-SH 20 µg $520
NRBF2 shRNA Plasmid (m) sc-150062-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
NRBF2 shRNA (h) Lentiviral Particles sc-90694-V 200 µl $625
NRBF2 shRNA (m) Lentiviral Particles sc-150062-V 200 µl $625
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human NRBF2 29982 10q21.2 Q96F24
 n/a
 

Nuclear hormone receptors function as transcriptional activators when their cognate ligands are bound. Binding of the appropriate ligand induces a conformational change in the nuclear receptor, allowing it to interact with transcriptional coactivators. NRBF2 (Nuclear receptor-binding factor 2), also known as COPR (Comodulator of PPAR and RXR), is thought to act as a transcriptional coactivator by altering the activity of target nuclear receptors. Highly expressed in the liver, placenta and keratinocytes, NRBF2 can interact with at least 7 nuclear receptors including PPARå, PPAR∂ and PPAR©. In the presence of a bound ligand, NRBF2 can interact with nuclear receptors RARå, RAR© and RXRå. NRBF2, which exists as two isoforms due to alternative splicing, is localized to both the nucleus and the cytoplasm.
NRBF2 Antibody (H-93) Data
Click on image to enlarge
sc-98419
NRBF2 (H-93): sc-98419. Western blot analysis of NRBF2 expression in PC-3 nuclear extract.
Download
Datasheets
Get Adobe Acrobat Reader