Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Lymphocyte Signaling » CD23 Antibodies » CD23 Antibody (M-282): sc-9152

CD23 Antibody (M-282): sc-9152

 |  Datasheet

(Based on data analysis)

  • CD23 Antibody (M-282) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 50-331 mapping within the extracellular domain of CD23 of mouse origin
  • recommended for detection of CD23 of mouse and rat origin by WB, IP, IF and ELISA
  • See 1 citations for CD23 Antibody (M-282)
 
Full-length CD23 protein sequence with immunogen highlighted:
MEENEYSGYWEPPRKRCCCARRGTQLMLVGLLSTAMWAGLLALLLLWHWETEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP

See additional CD23 Antibodies.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
CD23 Antibody (M-282) sc-9152 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD23 siRNA (m) sc-29977 10 µM $258
CD23 (m)-PR sc-29977-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD23 shRNA Plasmid (m) sc-29977-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CD23 shRNA (m) Lentiviral Particles sc-29977-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BC3H1 Cell Lysate sc-2299 500 µg/200 µl $104
CTLL-2 Cell Lysate sc-2242 500 µg/200 µl $104
F9 Cell Lysate sc-2245 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
RAW 264.7 Whole Cell Lysate sc-2211 500 µg/200 µl $104
CD23 (h3): 293T Lysate sc-174643 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Mouse Fcer2a 14128 8 A1.1 P20693
 N/A
 

The human leukocyte differentiation antigen CD23 (FCE2) is a type II integral membrane glycoprotein that is expressed on mature B cells, monocytes, eosinophils, platelets and dendritic cells. In mouse, CD23 is found only on mature B cells. CD23 is a low affinity IgE receptor that mediates IgE-dependent cytotoxicity and phagocytosis by macrophages and eosinophils. CD23 associates as an oligomer where cooperative binding of at least two lectin domains is required for high affinity IgE binding to CD23. It may play a role in antigen presentation by B cells by interacting with CD40. CD23 has been shown to be associated with the Fyn tyrosine kinase. The truncated molecule can be secreted, then function as a potent mitogenic growth factor. ADAM8, ADAM15, and MDC-L catalyze ectodomain shedding of CD23. Intestinal cells coexpress CD23a and CD23b, and the two splice forms show different localizations in polarized cells.

CD23 Antibody (M-282) Product Citations
See how others have used CD23 Antibody (M-282) and or CD23 Antibody (M-282) conjugates.


1 total citations
Loading citations.
 
CD23 Antibody (M-282) Data
Click on image to enlarge
sc-9152
CD23 (M-282): sc-9152. Western blot analysis of CD23 expression in BC3H1 (A), CTLL-2 (B), F9 (C), KNRK (D), NIH/3T3 (E) and RAW 264.7 (F) whole cell lysates.
sc-9152
Western blot analysis of CD23 expression in NIH/3T3 whole cell lysate immunoprecipitated with CD23 (FO14): sc-19631 and detected with CD23 (M-282): sc-9152.
sc-9152
CD23 (M-282): sc-9152. Western blot analysis of CD23 expression in non-transfected: sc-117752 (A) and human CD23 transfected: sc-174643 (B) 293T whole cell lysates and human platelet whole cell lysate (C).
Download
Datasheets
Get Adobe Acrobat Reader