Welcome to Santa Cruz Biotechnology!

Cdk7 Antibody (FL-346): sc-856

 |  Datasheet

(Based on data analysis)

  • Cdk7 Antibody (FL-346) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-346 representing full length Cdk7 of human origin
  • recommended for detection of Cdk7 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
  • TransCruz reagent for ChIP application, sc-856 X, 200 µg/0.1 ml
  • See 8 citations for Cdk7 Antibody (FL-346)
 
Full-length Cdk7 protein sequence with immunogen highlighted:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI

See additional Cdk Antibodies including Cdk, Cdk1, Cdk2, Cdk3, Cdk4, Cdk5, Cdk6, Cdk7, Cdk8, Cdk9, Cdk10 and Cdk11.

Also see Cdk7 Inhibitors for functional analysis of cellular responses to Cdk7.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Cdk7 Antibody (FL-346) sc-856 200 µg/ml $279
Cdk7 Antibody (FL-346) X sc-856 X 200 µg/0.1 ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Cdk7 siRNA (h) sc-29266 10 µM $258
Cdk7 siRNA (m) sc-29265 10 µM $258
Cdk7 siRNA (h2) sc-43678 10 µM $258
Cdk7 (h)-PR sc-29266-PR 10 µM, 20 µl $23
Cdk7 (m)-PR sc-29265-PR 10 µM, 20 µl $23
Cdk7 (h2)-PR sc-43678-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Cdk7 shRNA Plasmid (h) sc-29266-SH 20 µg $520
Cdk7 shRNA Plasmid (m) sc-29265-SH 20 µg $520
Cdk7 shRNA Plasmid (h2) sc-43678-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Cdk7 shRNA (h) Lentiviral Particles sc-29266-V 200 µl $625
Cdk7 shRNA (m) Lentiviral Particles sc-29265-V 200 µl $625
Cdk7 shRNA (h2) Lentiviral Particles sc-43678-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
K-562 nuclear extract sc-2130 250 µg/0.05 ml $143
Jurkat nuclear extract sc-2132 250 µg/0.05 ml $143
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
NIH/3T3 nuclear extract sc-2138 250 µg/0.05 ml $143
NIH/3T3 Whole Cell Lysate sc-2210 500 µg/200 µl $104
KNRK Whole Cell Lysate sc-2214 500 µg/200 µl $104
Cdk7 (m): 293T Lysate sc-119151 100 µg/200 µl $205
Cdk7 (h): 293 Lysate sc-110468 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CDK7 1022 5q13.2 NM_001799 P50613
601955
Mouse Cdk7 12572 13 D1 Q03147
N/A
 


Progression through the cell cycle requires activation of a series of enzymes designated cyclin dependent kinases (Cdks). The monomeric catalytic subunit Cdk2, a critical enzyme for initiation of cell cycle progression, is completely inactive. Partial activation is achieved by the binding of regulatory cyclins such as cyclin D1, while full activation requires additional phosphorylation at Thr 160. The enzyme responsible for the phosphorylation of Cdk2 on Thr 160 and also of Cdc2 p34 on Thr 161, designated Cdk-activating kinase (CAK), has been partially purified and shown to be comprised of a catalytic subunit and a regulatory subunit. The catalytic subunit, designated Cdk7, has been identified as the mammalian homolog of MO15, a protein kinase demonstrated in starfish and Xenopus. The regulatory subunit is a novel cyclin (cyclin H) and is required for activation of Cdk7. Like other Cdks, Cdk7 contains a conserved threonine residue required for full activity; mutation of this residue severely reduces CAK activity.

Cdk7 Antibody (FL-346) Product Citations
See how others have used Cdk7 Antibody (FL-346) and or Cdk7 Antibody (FL-346) conjugates.


8 total citations
Loading citations.
 
Cdk7 Antibody (FL-346) Data
Click on image to enlarge
Western blot analysis of Cdk7 expression in K-562 (A), Jurkat (B,D) and HeLa (C) nuclear extracts. Antibodies tested include Cdk7 (N-19): sc-723 (A,B) and Cdk7 (FL-346): sc-856 (C,D).
Cdk7 (FL-346): sc-856. Western blot analysis of Cdk7 expression in non-transfected: sc-110760 (A) and human Cdk7 transfected: sc-110468 (B) 293 whole cell lysates.
Cdk7 (FL-346): sc-856. Western blot analysis of Cdk7 expression in non-transfected: sc-117752 (A) and mouse Cdk7 transfected: sc-119151 (B) 293T whole cell lysates.
Cdk7 (FL-346): sc-856. Western blot analysis of Cdk7 expression in NIH/3T3 whole cell lysate.
Cdk7 (FL-346): sc-856. Western blot analysis of Cdk7 expression in K-562 (A), Jurkat (B), HeLa (C) and NIH/3T3 (D) nuclear extracts.
Cdk7 (FL-346): sc-856. Western blot analysis of Cdk7 expression in non-transfected: sc-110760 (A) and human Cdk7 transfected: sc-158371 (B) 293 whole cell lysates.
Download