Welcome to Santa Cruz Biotechnology!

c-Fos Antibody (D-1): sc-8047

 |  Datasheet

(Based on data analysis)

  • c-Fos Antibody (D-1) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 210-335 mapping at the C-terminus of c-Fos of human origin
  • recommended for detection of c-Fos of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-8047 X, 200 µg/0.1 ml
  • See 28 citations for c-Fos Antibody (D-1)
 
Full-length c-Fos protein sequence with immunogen highlighted:
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

See additional c-Fos Antibodies including c-Fos, c-Fos and Fos B.

Also see chemical c-Fos Activators for functional analysis of cellular responses to c-Fos.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   Gel Shift   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
c-Fos Antibody (D-1) sc-8047 200 µg/ml $279
c-Fos Antibody (D-1) X sc-8047 X 200 µg/0.1 ml $279
 CRISPR/Cas9 KO and HDR Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
c-Fos CRISPR/Cas9 KO Plasmid (m) sc-420400 20 µg $345
c-Fos HDR Plasmid (m) sc-420400-HDR 20 µg $385
c-Fos CRISPR/Cas9 KO Plasmid (h) sc-400009 20 µg $345
c-Fos HDR Plasmid (h) sc-400009-HDR 20 µg $385
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
c-Fos siRNA (h) sc-29221 10 µM $258
c-Fos siRNA (m) sc-29222 10 µM $258
c-Fos siRNA (h2) sc-44200 10 µM $258
c-Fos (h)-PR sc-29221-PR 10 µM, 20 µl $23
c-Fos (m)-PR sc-29222-PR 10 µM, 20 µl $23
c-Fos (h2)-PR sc-44200-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
c-Fos shRNA Plasmid (h) sc-29221-SH 20 µg $520
c-Fos shRNA Plasmid (m) sc-29222-SH 20 µg $520
c-Fos shRNA Plasmid (h2) sc-44200-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
c-Fos shRNA (h) Lentiviral Particles sc-29221-V 200 µl $625
c-Fos shRNA (m) Lentiviral Particles sc-29222-V 200 µl $625
c-Fos shRNA (h2) Lentiviral Particles sc-44200-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
A-431 Whole Cell Lysate sc-2201 500 µg/200 µl $104
A-431 nuclear extract sc-2122 250 µg/0.05 ml $143
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
Jurkat + PMA nuclear extract sc-2133 250 µg/0.05 ml $143
Y79 nuclear extract sc-2126 250 µg/0.05 ml $143
NIH/3T3 + PMA nuclear extract sc-2125 250 µg/0.05 ml $143
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human FOS 2353 14q24.3 NM_005252 P01100
164810
Mouse Fos 14281 12 D2 P01101
N/A
 


The c-Fos oncogene was initially detected in two independent murine osteosarcoma virus isolates and an avian nephroblastoma virus. The cellular homolog, c-Fos, encodes a nuclear phospho-protein that is rapidly and transiently induced by a variety of agents and functions as a transcriptional regulator for several genes. In contrast to c-Jun proteins, which form homo- and heterodimers which bind to specific DNA response elements, c-Fos proteins are only active as heterodimers with members of the Jun gene family. Functional homologs of c-Fos include the Fra-1, Fra-2 and Fos B genes. In addition, selected ATF/CREB family members can form leucine zipper dimers with Fos and Jun. Different dimers exhibit differential specificity and affinity for AP-1 and CRE sites.

c-Fos Antibody (D-1) Product Citations
See how others have used c-Fos Antibody (D-1) and or c-Fos Antibody (D-1) conjugates.


28 total citations
Loading citations.
 
c-Fos Antibody (D-1) Data
Click on image to enlarge
c-Fos (D-1): sc-8047. Western blot analysis of c-Fos expression in NIH/3T3 nuclear extract (A) and from PMA-treated NIH/3T3 nuclear extract (B).
c-Fos (D-1): sc-8047. Immunoperoxidase staining of formalin fixed, paraffin-embedded human adrenal gland tissue showing nuclear staining of glandular cells.
c-Fos (D-1): sc-8047. Immunofluorescence staining of formalin-fixed HepG2 cells showing nuclear localization.
Download