Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Growth Factors and Hormones » FGF Antibodies » FGF-1 Antibody (H-125): sc-7910

FGF-1 Antibody (H-125): sc-7910

 |  Datasheet

(Based on data analysis)

  • FGF-1 Antibody (H-125) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 16-140 representing all but the C-terminal 15 amino acids of mature FGF-1 of human origin
  • recommended for detection of FGF-1 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
  • See 3 citations for FGF-1 Antibody (H-125)
 
Full-length FGF-1 protein sequence with immunogen highlighted:
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

See additional FGF Antibodies including FGF-23, FGF-22, FGF-21, FGF-20, FGF-19, FGF-18, FGF-17, FGF-16, FGF-15, FGF-14, FGF-13, FGF-12, FGF-11, FGF-10, FGF-9, FGF-8, FGF-7, FGF-6, FGF-5, FGF-4, FGF-3, FGF-2, FGF-1 and FGF.

Also see FGF-1 Inhibitors for functional analysis of cellular responses to FGF-1.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
FGF-1 Antibody (H-125) sc-7910 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FGF-1 siRNA (h) sc-39444 10 µM $258
FGF-1 siRNA (m) sc-39445 10 µM $258
FGF-1 (h)-PR sc-39444-PR 10 µM, 20 µl $23
FGF-1 (m)-PR sc-39445-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FGF-1 shRNA Plasmid (h) sc-39444-SH 20 µg $520
FGF-1 shRNA Plasmid (m) sc-39445-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FGF-1 shRNA (h) Lentiviral Particles sc-39444-V 200 µl $625
FGF-1 shRNA (m) Lentiviral Particles sc-39445-V 200 µl $625
 WB Positive Control Cell Lysate (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
FGF-1 (h): 293T Lysate sc-115191 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human FGF1 2246 5q31.3 NM_000800, NM_033136, NM_033137 P05230
 131220
Mouse Fgf1 14164 18 B3 P61148
 N/A
 

Fibroblast growth factor-1 (FGF-1), also designated acidic FGF, and fibroblast growth factor-2 (FGF-2), also designated basic FGF, are members of a family of growth factors that stimulate proliferation of cells of mesenchymal, epithe-lial and neuroectodermal origin. Additional members of the FGF family include the oncogenes FGF-3 (Int2) and FGF-4 (hst/Kaposi), FGF-5, FGF-6, FGF-7 (KGF), FGF-8 (AIGF), FGF-9 (GAF) and FGF-10–FGF-23. Members of the FGF family share 30-55% amino acid sequence identity and similar gene structure, and are capable of transforming cultured cells when overexpressed in transfected cells. Cellular receptors for FGFs are members of a second multigene family including four tyrosine kinases, designated Flg (FGFR-1), Bek (FGFR-L), TKF and FGFR-3.

FGF-1 Antibody (H-125) Product Citations
See how others have used FGF-1 Antibody (H-125) and or FGF-1 Antibody (H-125) conjugates.


3 total citations
Loading citations.
 
FGF-1 Antibody (H-125) Data
Click on image to enlarge
sc-7910
FGF-1 (H-125): sc-7910. Western blot analysis of FGF-1 expression in non-transfected: sc-117752 (A) and human FGF-1 transfected: sc-115191 (B) 293T whole cell lysates.
sc-7910
FGF-1 (H-125): sc-7910. Immunoperoxidase staining of formalin fixed, paraffin-embedded human kidney tissue showing cytoplasmic staining of cells in glomerulus and tubules.
Download
Datasheets
Get Adobe Acrobat Reader