Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Signaling Intermediates » Arrestin Antibodies » β-Arrestin-1/2 Antibody (A-1): sc-74591

β-Arrestin-1/2 Antibody (A-1): sc-74591

 |  Datasheet

(Based on data analysis)

  • β-Arrestin-1/2 Antibody (A-1) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 7-290 mapping near the N-terminus of β-Arrestin-1 of human origin
  • recommended for detection of β-Arrestin-1, and 2, and to a lesser extent, S-Arrestin of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including porcine
 
Full-length β-Arrestin-1/2 protein sequence with immunogen highlighted:
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

See additional Arrestin Antibodies including Arrestin, Arrestin-C, beta-Arrestin-1, Visual Arrestin and beta-Arrestin-2.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
β-Arrestin-1/2 Antibody (A-1) sc-74591 200 µg/ml $279
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
PC-12 Cell Lysate sc-2250 500 µg/200 µl $104
SK-N-MC Cell Lysate sc-2237 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
A549 Cell Lysate sc-2413 500 µg/200 µl $104
RAW 264.7 Whole Cell Lysate sc-2211 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ARRB1 408 11q13.4 P49407
 107940
Human ARRB2 409 17p13.2 P32121
 107941
Mouse Arrb1 109689 7 E2 Q8BWG8
 N/A
Mouse Arrb2 216869 11 B3 Q91YI4
 N/A
 

The members of the G protein coupled receptor family are distinguished by their slow transmitting response to ligand binding. These seven transmembrane proteins include the adrenergic, serotonin and dopamine receptors (1). The effect of the signaling molecule can be excitatory or inhibitory depending on the type of receptor to which it binds (2,3). Members of the ∫-Arrestin family regulate receptor binding to G proteins (4). ∫-Arrestins have been found to be located at postsynaptic sites, where they are thought to act in concert with ∫ARK (∫ARK1, also designated GRK 2, or ∫ARK2, also designated GRK 3) to regulate G protein-coupled neurotransmitter receptors. Expression of ∫-Arrestin-1 and b-Arrestin-2 is seen predominantly in spleen and neuronal tissues (5). It has been shown that ∫-Arrestin-1 expression is modulated by intracellular cAMP, which may be a novel mechanism for the regulation of receptor-mediated responses (6).
β-Arrestin-1/2 Antibody (A-1) Data
Click on image to enlarge
sc-74591
β-Arrestin-1/2 (A-1): sc-74591. Western blot analysis of β-Arrestin-1/2 expression in RAW 264.7 (A) and PC-12 (B) whole cell lysates.
sc-74591
b-Arrestin-1/2 (A-1): sc-74591. Western blot analysis of b-Arrestin-1/2 expression in SK-N-MC (A), Hep G2 (B), T84 (C), NTERA-2 cl.D1 (D) and A549 (E) whole cell lysates.
sc-74591
β-Arrestin-1/2 (A-1): sc-74591. Immunoperoxidase staining of formalin fixed, paraffin-embedded human kidney tissue showing cytoplasmic staining of glomerular cells.
Download
Datasheets
Get Adobe Acrobat Reader