Welcome to Santa Cruz Biotechnology!

XBP-1 Antibody (M-186): sc-7160

 |  Datasheet

(Based on data analysis)

  • XBP-1 Antibody (M-186) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 76–263 of XBP-1 (X-box binding protein-1) of mouse origin
  • recommended for detection of XBP-1U and XBP-1S isoforms of mouse, rat and human origin by WB, IP, IF and ELISA
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-7160 X, 200 µg/0.1 ml
  • See 50 citations for XBP-1 Antibody (M-186)
 
Full-length XBP-1 protein sequence with immunogen highlighted:
MVVVAAAPSAATAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGVRLVAGSAESAALRLCAPLQQVQAQLSPPQNIFPWTLTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLVWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL

See additional XBP Antibodies including XBP-1, XBP-1U and XBP.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   Gel Shift   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
XBP-1 Antibody (M-186) sc-7160 200 µg/ml $279
XBP-1 Antibody (M-186) X sc-7160 X 200 µg/0.1 ml $279
 CRISPR/Cas9 KO and HDR Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
XBP-1 CRISPR/Cas9 KO Plasmid (h) sc-400131 20 µg $345
XBP-1 HDR Plasmid (h) sc-400131-HDR 20 µg $385
XBP-1 CRISPR/Cas9 KO Plasmid (m) sc-423727 20 µg $345
XBP-1 HDR Plasmid (m) sc-423727-HDR 20 µg $385
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
XBP-1 siRNA (h) sc-38627 10 µM $258
XBP-1 siRNA (m) sc-38628 10 µM $258
XBP-1 (h)-PR sc-38627-PR 10 µM, 20 µl $23
XBP-1 (m)-PR sc-38628-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
XBP-1 shRNA Plasmid (h) sc-38627-SH 20 µg $520
XBP-1 shRNA Plasmid (m) sc-38628-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
XBP-1 shRNA (h) Lentiviral Particles sc-38627-V 200 µl $625
XBP-1 shRNA (m) Lentiviral Particles sc-38628-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
BJAB nuclear extract sc-2145 250 µg/0.05 ml $143
MDA-MB-231 Cell Lysate sc-2232 500 µg/200 µl $104
Ramos nuclear extract sc-2153 250 µg/0.05 ml $143
U-87 MG Cell Lysate sc-2411 500 µg/200 µl $104
MDA-MB-231 Cell Lysate sc-2232 500 µg/200 µl $104
SK-BR-3 Cell Lysate sc-2218 500 µg/200 µl $104
XBP-1 (h): 293 Lysate sc-110810 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human XBP1 7494 22q12.1 NM_005080 P17861
194355
Mouse Xbp1 22433 11 A1 O35426
N/A
 


The X-box binding protein-1 (XBP-1 or hXBP-1), also designated tax-responsive element-binding protein 5 (TREB5) in mouse and human, or hepatocarcinogenesis-related transcription factor (HTF) in rat, belongs to the basic region/leucine zipper (bZIP) family of transcription factors. XBP-1 was first characterized as a protein that binds to the HLA-DRå promoter in B cells. XBP-1 recognizes the cAMP responsive element (CRE) in enhancers of human T cell leukemia virus and major histocompatibility complex class II genes and activates transcription of these genes. It is expressed at high levels in developing bone and its levels are modulated during osteoblast development, suggesting a role in regulation of expression of osteoblast-specific genes. In addition to binding to CRE sequences, XBP-1 has been shown to bind to TPA response elements (TREs).

XBP-1 Antibody (M-186) Product Citations
See how others have used XBP-1 Antibody (M-186) and or XBP-1 Antibody (M-186) conjugates.


50 total citations
Loading citations.
 
XBP-1 Antibody (M-186) Data
Click on image to enlarge
XBP-1 (M-186): sc-7160. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear and cytoplasmic localization.
XBP-1 (M-186): sc-7160. Western blot analysis of XBP-1 expression in BJAB (A) and Ramos (B) nuclear extracts.
XBP-1 (M-186): sc-7160. Western blot analysis of XBP-1 expression in non-transfected: sc-110760 (A) and human XBP-1 transfected: sc-110810 (B) 293 whole cell lysates.
XBP-1 (M-186): sc-7160. Western blot analysis of XBP-1 expression in THP-1 nuclear extract.
Download