Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Synthesis and Degradation » Carbonic Anhydrases Antibodies » CA VII Antibody (H-90): sc-67331

CA VII Antibody (H-90): sc-67331

 |  Datasheet

(Based on data analysis)

  • CA VII Antibody (H-90) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-90 mapping at the N-terminus of CA VII of human origin
  • recommended for detection of CA VII of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including bovine and canine
 
Full-length CA VII protein sequence with immunogen highlighted:
MTGHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA

See additional Carbonic Anhydrases Antibodies including Carbonic Anhydrases, CA I, CA II, CA III, CA IV, CA IX, CA V, CA VB, CA VI, CA VII, CA VIII, CA X, CA XI, CA XII, CA XIII, CA XIV and CA XV.

Also see Carbonic Anhydrases Inhibitors for functional analysis of cellular responses to Carbonic Anhydrases.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
CA VII Antibody (H-90) sc-67331 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CA VII siRNA (h) sc-62036 10 µM $258
CA VII siRNA (m) sc-62037 10 µM $258
CA VII (h)-PR sc-62036-PR 10 µM, 20 µl $23
CA VII (m)-PR sc-62037-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CA VII shRNA Plasmid (h) sc-62036-SH 20 µg $520
CA VII shRNA Plasmid (m) sc-62037-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CA VII shRNA (h) Lentiviral Particles sc-62036-V 200 µl $625
CA VII shRNA (m) Lentiviral Particles sc-62037-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
CA VII (h): 293T Lysate sc-115027 100 µg/200 µl $205
AFP (h2): 293T Lysate sc-170237 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CA7 766 16q22.1 NM_001014435, NM_005182 P43166
 114770
Mouse Car7 12354 8 D3 Q9ERQ8
 N/A
 

Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes responsible for catalyzing the reversible hydration of carbon dioxide. CAs show extensive diversity in their distribution and subcellular localization. They are involved in a variety of biological processes, including calcification, bone resorption, respiration, acid-base balance and the formation of aqueous humor, saliva, gastric juice and cerebrospinal fluid. CA VII, also known as carbonate dehydratase VII, is a highly conserved mammlian carbonic anhydrase. It localizes to the cytoplasm and is ubiquitiously expressed at low levels, but is present at significant levels in brain and salivary glands. CA VII may influence GABAergic excitation in neurons and contribute to the triggering of convulsions common to neurological disorders. Due to the high expression level of CA VII in brain, it may be useful in the development of pharmacologic agents for managing epilepsy and Alzheimer’s disease.
CA VII Antibody (H-90) Data
Click on image to enlarge
sc-67331
CA VII (H-90): sc-67331. Western blot analysis of CA VII expression in non-transfected: sc-117752 (A) and human CA VII transfected: sc-115027 (B) 293T whole cell lysates.
sc-67331
CA VII (H-90): sc-67331. Western blot analysis of CA VII expression in non-transfected: sc-117752 (A) and human CA VII transfected: sc-170270 (B) 293T whole cell lysates.
Download
Datasheets
Get Adobe Acrobat Reader