Welcome to Santa Cruz Biotechnology!

ZBP1 Antibody (R-259): sc-67257

 |  Datasheet

(Based on data analysis)

  • ZBP1 Antibody (R-259) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 12-270 mapping at the N-terminus of ZBP1 of rat origin
  • recommended for detection of ZBP1 of rat and, to a lesser extent, mouse origin by WB, IP, IF and ELISA
 
Full-length ZBP1 protein sequence with immunogen highlighted:
MAEASVDLGTGDNLEQKILQVLSDAGSPVQIDQLLKKLQVPKKILNQVLYRLKKEGRVSSPAPATWSLGGDGASGDGAPEIPEDSAAQPSLEERILRFLETKGPQRALHIAKALGMTTAKEVNPILYSMRNKHLLTVSDTQMWTIYRSSQEGQERACSGVGQESPAVIYQQNPINMICQQGPNSLISISNSKAIQIGHGNVMSRQTICGDPGPGTPHHAPLPVLEDAAAQDTPPGTHGAQLIHLNKSMLRRVQLGHGNEMNLERDPVEHPIFSFSSSPPESTTTADPETAFNMQTPEPGPHPEGGTTQIVHIKSCLLEDTTVGNNNKMTIHRRSKGGTKESADSQELKEDTGASSEATPPRSCLHTPSDSTLLTSELTAMALGDGSPQITESMLREDEVQAAETCQTQD

See additional ZBP Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
ZBP1 Antibody (R-259) sc-67257 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ZBP1 siRNA (m) sc-61823 10 µM $258
ZBP1 (m)-PR sc-61823-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ZBP1 shRNA Plasmid (m) sc-61823-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
ZBP1 shRNA (m) Lentiviral Particles sc-61823-V 200 µl $625
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Mouse Zbp1 58203 2 H3 Q9QY24
N/A
 


Left-handed Z-DNA is a higher energy form of the double helix. Proteins containing Za domains share a remarkable ability to bind specifically to Z-DNA and/or Z-RNA. ZBP1 (Z-DNA binding protein 1), also designated DLM-1, is a 429 amino acid protein that harbors two copies of the Za domain containing the Za motif at its N-terminus. ZBP1 is involved in host responses against cellular stresses, including tumorigenesis and viral infection. It is highly expressed in lymphatic tissues including leukocytes, lymph node, tonsil, bone marrow, spleen and, to a lesser extent, in thymus, lung and liver. There are five known isoforms of human ZBP1. The ZBP1 protein shares 47% and 46% sequence identity with the mouse and rat homologs, respectively. The mouse, rat, and human ZBP1 proteins all contain four conserved regions, two of which are homologous to the Z-DNA binding domains Za and Zb of the RNA editing enzyme ADAR1.

ZBP1 Antibody (R-259) Data
Click on image to enlarge
ZBP1 (R-259): sc-67257. Western blot analysis of ZBP1 expression in non-transfected: sc-117752 (A) and mouse ZBP1 transfected: sc-127799 (B) 293T whole cell lysates.
ZBP1 (R-259): sc-67257. Western blot analysis of ZBP1 expression in non-transfected: sc-117752 (A) and mouse ZBP1 transfected: sc-127799 (B) 293T whole cell lysates and mouse liver (C) and rat liver (D) tissue extracts.
Download