Welcome to Santa Cruz Biotechnology!

Bax Antibody (Δ 21): sc-6236

 |  Datasheet

(Based on data analysis)

  • Bax Antibody (Δ 21) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-171 representing all but the C-terminal 21 amino acids of Baxα of mouse origin
  • recommended for detection of Baxα and Baxβ of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including canine, bovine and porcine
  • See 48 citations for Bax Antibody (Δ 21)
 
Full-length Bax protein sequence with immunogen highlighted:
MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWTVTIFVAGVLTASLTIWKKMG

See additional Bax Antibodies including Bax and Bax beta.

Also see Bax Activators for functional analysis of cellular responses to Bax.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Bax Antibody (Δ 21) sc-6236 200 µg/ml $279
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
CTLL-2 Cell Lysate sc-2242 500 µg/200 µl $104
Bax (m): 293T Lysate sc-126476 100 µg/200 µl $205
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
COLO 320DM Cell Lysate sc-2226 500 µg/200 µl $104
HuT 78 Whole Cell Lysate sc-2208 500 µg/200 µl $104
CCRF-CEM Cell Lysate sc-2225 500 µg/200 µl $104
Ramos Cell Lysate sc-2216 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human BAX 581 19q13.33 NM_004324, NM_138761, NM_138763, NM_138764, NM_138765 Q07812
600040
Mouse Bax 12028 7 B4 Q07813
N/A
 


The Bcl-2 gene was isolated at the chromosomal breakpoint of t-bearing follicular B cell lymphomas. Bcl-2 blocks cell death following a variety of stimuli and confers a death-sparing effect to certain hematopoietic cell lines following growth factor withdrawal. Bcl-2 is localized to outer mitochondrial membranes and endoplasmic reticulum as well as nuclear membranes. A related protein, designated Bax (Bcl-associated X protein), has extensive amino acid homology with Bcl-2 and both homodimerizes and forms heterodimers with Bcl-2. Overexpression of Bax accelerates apoptotic death induced by cytokine deprivation in an IL-3 dependent cell line and Bax also counters the death repressor activity of Bcl-2.

Bax Antibody (Δ 21) Product Citations
See how others have used Bax Antibody (Δ 21) and or Bax Antibody (Δ 21) conjugates.


48 total citations
Loading citations.
 
Bax Antibody (Δ 21) Data
Click on image to enlarge
Bax (Δ 21): sc-6236. Western blot analysis of Bax expression in RAW 264.7 whole cell lysate.
Bax (Δ 21): sc-6236. Immunofluorescence staining of methanol-fixed RAW 264.7 cells showing cytoplasmic localization.
Bax (Δ 21): sc-6236. Immunoperoxidase staining of formalin fixed, paraffin-embedded human colon tissue showing cytoplasmic staining of smooth muscle cells.
Download