Welcome to Santa Cruz Biotechnology!

AChRα4 Antibody (H-133): sc-5591

 |  Datasheet

(Based on data analysis)

  • AChRα4 Antibody (H-133) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 342-474 of acetylcholine receptor alpha 4 subunit of human origin
  • recommended for detection of AChRα4 of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA
  • See 11 citations for AChRα4 Antibody (H-133)
 
Full-length AChRα4 protein sequence with immunogen highlighted:
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGPSCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEGGVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI

See additional AChR Antibodies including AChR, AChR alpha 1, AChR delta, AChR epsilon, AChR gamma, AChRalpha, AChRbeta, AChRbeta1, AChR alpha 2, AChRbeta2, AChR alpha 3, AChRbeta3, AChR alpha 4, AChR alpha 5, AChR alpha 6, AChR alpha 7, AChR alpha 8, AChR alpha 9 and AChR alpha 10.

Also see AChR alpha 4 Inhibitors or AChR alpha 4 Activators for functional analysis of cellular responses to AChR alpha 4.


Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
AChRα4 Antibody (H-133) sc-5591 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AChRα4 siRNA (h) sc-42528 10 µM $258
AChRα4 siRNA (m) sc-42529 10 µM $258
AChRα4 (h)-PR sc-42528-PR 10 µM, 20 µl $23
AChRα4 (m)-PR sc-42529-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AChRα4 shRNA Plasmid (h) sc-42528-SH 20 µg $520
AChRα4 shRNA Plasmid (m) sc-42529-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
AChRα4 shRNA (h) Lentiviral Particles sc-42528-V 200 µl $625
AChRα4 shRNA (m) Lentiviral Particles sc-42529-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
A-673 Cell Lysate sc-2414 500 µg/200 µl $104
Sol8 Cell Lysate sc-2249 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CHRNA4 1137 20q13.33 NM_000744 P43681
600513
Mouse Chrna4 11438 2 H4 O70174
N/A
 


Members of the ligand-gated ion channel receptor family are characterized by their fast transmitting response to neurotransmitters. Two important members of this family are the nicotinic acetylcholine and glutamate receptors, both of which are composed of five homologous subunits forming a transmembrane aqueous pore. These transmembrane receptors change conformation in response to their cognate neurotransmitter. Nicotinic acetylcholine receptors are found at the postsynaptic membrane of the neuromuscular junction and bind acetylcholine molecules, allowing ions to move through the pore. Glutamate receptors are found in the postsynaptic membrane of cells in the central nervous system. The activity that is generated at the synapse by the binding of acetylcholine is terminated by acetylcholinesterase, an enzyme that rapidly hydrolyzes acetylcholine. AChRå4, also known as EBN, BFNC, EBN1, NACHR, NACRA4, NACHRA4 or CHRNA4, is a 627 amino acid multi-pass membrane protein associated with nocturnal frontal lobe epilepsy type 1 (ENFL1), an autosomal dominant epilepsy characterized by nocturnal seizures with hyperkinetic automatisms and poorly organized stereotyped movements.

AChRα4 Antibody (H-133) Product Citations
See how others have used AChRα4 Antibody (H-133) and or AChRα4 Antibody (H-133) conjugates.


11 total citations
Loading citations.
 
AChRα4 Antibody (H-133) Data
Click on image to enlarge
AChRα4 (H-133): sc-5591. Western blot analysis of AChRα4 expression in Sol8 (A) and PC-12 (B) whole cell lysates.
AChRα4 (H-133): sc-5591. Immunoperoxidase staining of formalin fixed, paraffin-embedded human small intestine tissue showing cytoplasmic staining of glandular cells.
Download