Welcome to Santa Cruz Biotechnology!

AIF Antibody (B-9): sc-55519

 |  Datasheet

(Based on data analysis)

  • AIF Antibody (B-9) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-300 mapping at the N-terminus of AIF of human origin
  • recommended for detection of AIF of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
  • See 5 citations for AIF Antibody (B-9)
 
Full-length AIF protein sequence with immunogen highlighted:
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

See additional AIF Antibodies including AIF and AIFL.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAddFavorites
AIF Antibody (B-9) sc-55519 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
AIF siRNA (h) sc-29193 10 µM $258
AIF siRNA (m) sc-29194 10 µM $258
AIF (h)-PR sc-29193-PR 10 µM, 20 µl $23
AIF (m)-PR sc-29194-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
AIF shRNA Plasmid (h) sc-29193-SH 20 µg $520
AIF shRNA Plasmid (m) sc-29194-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
AIF shRNA (h) Lentiviral Particles sc-29193-V 200 µl $625
AIF shRNA (m) Lentiviral Particles sc-29194-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAddFavorites
AIF (m): 293T Lysate sc-118296 100 µg/200 µl $205
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
CCRF-CEM Cell Lysate sc-2225 500 µg/200 µl $104
Hep G2 Cell Lysate sc-2227 500 µg/200 µl $104
MOLT-4 Cell Lysate sc-2233 500 µg/200 µl $104
CTLL-2 Cell Lysate sc-2242 500 µg/200 µl $104
HeLa Whole Cell Lysate sc-2200 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human AIFM1 9131 Xq25 NM_004208, NM_145812, NM_145813 O95831
300169
Mouse Aifm1 26926 X A4 Q9Z0X1
N/A
 


A key event in the apoptotic process is the opening of the mitochondrial permeability transition pore, an event that is regulated by Bcl-2 family proteins, resulting in the release of several proteins from the mitochondrial intermembrane space. Several of these proteins participate in apoptosis, including cytochrome c, procaspases 2, 3, and 9, and AIF (apoptosis-inducing factor). AIF has been shown to cause DNA fragmentation and chromatin condensation and to induce the release of cytochrome c and caspase-9 from mitochondria. Bcl-2 overexpression has been shown to prevent the release of AIF from mitochondria, but not to block its apoptogenic activity.

AIF Antibody (B-9) Product Citations
See how others have used AIF Antibody (B-9) and or AIF Antibody (B-9) conjugates.


5 total citations
Loading citations.
 
AIF Antibody (B-9) Data
Click on image to enlarge
AIF (B-9): sc-55519. Western blot analysis of AIF expression in HeLa (A), Jurkat (B) and CTLL-2 (C) whole cell lysates.
AIF (B-9): sc-55519. Western blot analysis of AIF expression in non-transfected: sc-117752 (A) and mouse AIF transfected: sc-118296 (B) 293T whole cell lysates.
AIF (B-9): sc-55519. Western blot analysis of AIF expression in non-transfected 293T: sc-117752 (A), human AIF transfected 293T: sc-111943 (B) and HeLa (C) whole cell lysates.
AIF (B-9): sc-55519. Immunoperoxidase staining of formalin fixed, paraffin-embedded human testis tissue showing cytoplasmic staining of Leydig cells and cells in seminiferous ducts.
Download