Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Structural Proteins » Tctex Antibodies » Tctex2 Antibody (M-191): sc-48760

Tctex2 Antibody (M-191): sc-48760

 |  Datasheet

(Based on data analysis)
  • Tctex2 Antibody (M-191) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-191 representing full length Tctex2 of mouse origin
  • recommended for detection of Tctex2 long and short isoforms of mouse, rat and human origin by WB, IP, IF and ELISA
 
Full-length Tctex2 protein sequence with immunogen highlighted:
MERRGRMAKTPTGQTHQSPVSKRERKPSMFEKESYAQILRERLRESFHDVQYVEPPFDDSIADVGKEWKSALAKLKFANSYRMEPLKKFQAHLVETKIQQILKDSLKDVKYDDKAPHLSLELADGILAAVKEFAYHRYKFIIQVLFIQKTGQAINIASRWIWDVAWDNWVEAKHETESYVVLALVFALYC

See additional Tctex Antibodies including Tctex, Tctex1, Tctex1L, Tctex2, Tctex2 beta and Tctex5.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Tctex2 Antibody (M-191) sc-48760 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Tctex2 siRNA (h) sc-43457 10 µM $258
Tctex2 siRNA (m) sc-43458 10 µM $258
Tctex2 (h)-PR sc-43457-PR 10 µM, 20 µl $23
Tctex2 (m)-PR sc-43458-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Tctex2 shRNA Plasmid (h) sc-43457-SH 20 µg $520
Tctex2 shRNA Plasmid (m) sc-43458-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Tctex2 shRNA (h) Lentiviral Particles sc-43457-V 200 µl $625
Tctex2 shRNA (m) Lentiviral Particles sc-43458-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
mouse testis extract sc-2405 500 µg/200 µl $104
rat testis extract sc-2400 500 µg/200 µl $104
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human TCTE3 6991 6q27 NM_174910 NP_777570
 186977
Mouse Tcte3 21647 17 A2 P11985
 N/A
 

Tctex2 (t-complex testis expressed 2) is one of the distorter genes of the mouse t haplotype (1). This complex is responsible for the transmission ratio distortion phenomenon, in which the chromosomes of heterozygous +/t males are preferentially segregated so that the t haplotype is transmitted to >95% of the offspring (1). Transmission ratio distortion of t haplotypes involves dysfunction of both flagellar inner and outer dynein arms (2). Tctex2 might be a light chain of flagellar outer arm dynein and the abortive phosphorylation of Tctex2/outer arm dynein, light chain might be related to the less progressive movement of sperm (3). Tctex2 maps to the t-complex and encodes a membrane-associated protein found exclusively on the sperm tail (4,5).
Tctex2 Antibody (M-191) Data
Click on image to enlarge
sc-48760
Tctex2 (M-191): sc-48760. Western blot analysis of mouse recombinant Tctex2 fusion protein.
Download
Datasheets
Get Adobe Acrobat Reader