Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transcription Regulators » Id Antibodies » Id1 Antibody (Z-8): sc-427

Id1 Antibody (Z-8): sc-427

 |  Datasheet

(Based on data analysis)

  • Id1 Antibody (Z-8) is a rabbit polyclonal IgG provided at 200 µg/ml
  • produced by immunization with full length Id1 protein of mouse origin corresponding to amino acids 1-148
  • recommended for detection of Id1, Id2, Id3 and Id4 of mouse, rat and human origin by WB, IP, IF and ELISA
  • See 15 citations for Id1 Antibody (Z-8)
 
Full-length Id1 protein sequence with immunogen highlighted:
CTTFLQLLVLFPHSVLSLLRSPPPVLRIMKVASGSAAAAAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRPLSTLNGEISALAAEAACVPADDRILCR

See additional Id Antibodies including Id, Id1, Id2, Id3 and Id4.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Id1 Antibody (Z-8) sc-427 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Id1 siRNA (h2) sc-44267 10 µM $258
Id1 (h2)-PR sc-44267-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
PC-12 + NGF Cell Lysate sc-3808 500 µg/200 µl $104
Id1 (h): 293 Lysate sc-113028 100 µg/200 µl $205
Id1 (h2): 293T Lysate sc-171632 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ID1 3397 20q11.21 NM_002165, NM_181353 P41134
 600349
Mouse Id1 15901 2 H1 P20067
 N/A
 

Members of the Id family of basic helix-loop-helix (bHLH) proteins include Id1, Id2, Id3 and Id4. They are ubiquitously expressed and dimerize with members of the class A and B HLH proteins. Due to the absence of the basic region, the resulting heterodimers cannot bind DNA. The Id-type proteins thus appear to negatively regulate DNA binding of bHLH proteins. Since Id1 inhibits DNA binding of E12 and Myo D, it apparently functions to inhibit muscle-specific gene expression. Under conditions that facilitate muscle cell differentiation, the Id protein levels fall, allowing E12 and/or E47 to form heterodimers with Myo D and myogenin, which in turn activate myogenic differentiation. It has been shown that expression of each of the Id proteins is strongly dependent on growth factor activation and that reduction of Id mRNA levels by antisense oligonucleotides leads to a delayed reentry of arrested cells into the cell cycle following growth factor stimulation.

Id1 Antibody (Z-8) Product Citations
See how others have used Id1 Antibody (Z-8) and or Id1 Antibody (Z-8) conjugates.


15 total citations
Loading citations.
 
Id1 Antibody (Z-8) Data
Click on image to enlarge
sc-427
Western blot analysis of human recombinant Id1 (A,C) and Id1 His-tagged mouse recombinant Id1 (B,D) fusion proteins. Antibodies tested include Id1 (Z-8): sc-427 (A,B) and Id1 (C-20): sc-488 (C,D).
sc-427
Id1 (Z-8): sc-427. Western blot analysis of Id1 expression in NGF-induced PC-12 whole cell lysate.
sc-427
Id1 (Z-8): sc-427. Western blot analysis of Id1 expression in non-transfected: sc-110760 (A) and human Id1 transfected: sc-113028 (B) 293 whole cell lysates.
sc-427
Id1 (Z-8): sc-427. Western blot analysis of Id1 expression in non-transfected: sc-117752 (A) and human Id1 transfected: sc-171632 (B) 293T whole cell lysates.
Download
Datasheets
Get Adobe Acrobat Reader