Welcome to Santa Cruz Biotechnology!

Coronin 1C Antibody (D-9): sc-376919

 |  Datasheet

(Based on data analysis)

  • Coronin 1C Antibody (D-9) is a mouse monoclonal IgM provided at 200 µg/ml
  • raised against amino acids 390-474 mapping at the C-terminus of Coronin 1C of human origin
  • recommended for detection of Coronin 1C of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length Coronin 1C protein sequence with immunogen highlighted:
MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA

See additional Coronin Antibodies including Coronin, Coronin 1A, Coronin 1B, Coronin 1C, Coronin 6, Coronin 2A, Coronin 2B and Coronin 7.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Coronin 1C Antibody (D-9) sc-376919 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CORO1C 23603 12q23.3 NM_014325 Q9ULV4
605269
 


Coronins are a family of WD repeat-containing, actin-binding proteins that localize to submembraneous areas and regulate cell motility and cytoskeletal rearrangement. Coronin 1A (CORO1A, CLIPINA, CLABP, TACO, p57) can form coiled coil-mediated homotrimeric complexes that influence early phagosome formation. PKC-dependent phosphorylation of Coronin 1B (CORO1B) at Serine 2 regulates leading edge dynamics and cell motility in fibroblasts through interactions with Arp2/3 complex. Coronin 1C (CORO1C, Coronin 3, HCRNN4) is abundant in differentiating Neuro-2a cells, PC-12 cells and primary oligodendrocytes, where it is thought to influence neuron morphogenesis and migration. Coronin 2A (CORO2A, CLIPINB, IR10, WDR2) is a component of the approximately 1.5-2 megadalton N-CoR (nuclear receptor corepressor) complex of 10-12 proteins, which recruits HDACs to generate repressive chromatin. Coronin 7 (CORO7, CRN7) localizes to the Golgi membrane and influences the organization of intracellular membrane compartments and vesicular trafficking. Coronin 2B (CORO2B, CLIPINC) and Coronin 6 (CORO6) are similar to other members of this family, since they possess a conserved basic N-terminal motif and 3-10 WD repeats clustered in one to two core domains.

Coronin 1C Antibody (D-9) Data
Click on image to enlarge
Coronin 1C (D-9): sc-376919. Western blot analysis of Coronin 1C expression in HeLa nuclear extract (A) and T24 whole cell lysate (B).
Coronin 1C (D-9): sc-376919. Immunoperoxidase staining of formalin fixed, paraffin-embedded human liver tissue showing membrane staining of bile duct cells and cytoplasmic and membrane staining of hepatic sinusoids.
Download