Welcome to Santa Cruz Biotechnology!

Selenoprotein P Antibody (B-9): sc-376858

 |  Datasheet

(Based on data analysis)

  • Selenoprotein P Antibody (B-9) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 82-381 mapping at the C-terminus of Selenoprotein P of human origin
  • recommended for detection of Selenoprotein P of human origin by WB, IP, IHC(P), IF and ELISA
 
Full-length Selenoprotein P protein sequence with immunogen highlighted:
MWRSLGLALALCLLPSGGTESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASCYLCIIEASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSCCCHCRHLIFEKTGSAITCQCKENLPSLCSCQGLRAEENITESCQCRLPPAACQISQQLIPTEASASCRCKNQAKKCECPSN

See additional Selenoprotein Antibodies including Selenoprotein, Selenoprotein I, Selenoprotein K, Selenoprotein M, Selenoprotein M marker, Selenoprotein N, Selenoprotein O, Selenoprotein P, Selenoprotein R, Selenoprotein S, Selenoprotein T, Selenoprotein V and Selenoprotein W.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Selenoprotein P Antibody (B-9) sc-376858 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human SEPP1 6414 5p12 NM_001085486, NM_001093726, NM_005410 P49908
601484
 


Selenium is an essential trace element that is incorporated as selenocysteine into the primary structure of selenoproteins. Nutritional deficiency of selenium decreases selenoprotein concentrations and leads to pathologic conditions. Most of the known selenoproteins are members of the glutathione peroxidase or iodothyronine deiodinase families. Selenoprotein P (SEPP1) is a major selenoprotein that is not a member of those families. It is an extracellular glycoprotein that is present in several isoforms and is the only selenoprotein known to contain multiple selenocysteine residues. Selenoprotein P is a heparin-binding protein that appears to be associated with endothelial cells and has been implicated as an oxidant defense in the extracellular space. Although there is evidence of several isoforms of the protein, all of them share the same amino-terminal sequence and therefore are likely products of the same gene. The gene which encodes Selenoprotein P maps to human chromosome 5q31.

Selenoprotein P Antibody (B-9) Data
Click on image to enlarge
Selenoprotein P (B-9): sc-376858. Western blot analysis of Selenoprotein P expression in K-562 (A) and Hep G2 (B) whole cell lysates.
Selenoprotein P (B-9): sc-376858. Immunoperoxidase staining of formalin fixed, paraffin-embedded human pancreas tissue showing cytoplasmic staining of subset of glandular cells.
Download