Welcome to Santa Cruz Biotechnology!

PP2A-Cα/β Antibody (D-3): sc-376824

 |  Datasheet

(Based on data analysis)

  • PP2A-Cα/β Antibody (D-3) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-309 representing full length PP2A-Cα of human origin
  • recommended for detection of PP2A-Cα/β of human origin by WB, IP, IF and ELISA; also reactive with additional species, including canine, bovine, porcine and avian
 
Full-length PP2A-Cα/β protein sequence with immunogen highlighted:
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF

See additional PP2 Antibodies including PP2, PP2A-B55-β , PP2A-B55-δ, PP2A-Cβ, PP2Comega, PP2A-A alpha, PP2A-A alpha / beta, PP2A-C , PP2A-C alpha, PP2A-C alpha / beta, PP2B-A, PP2B-A alpha, PP2B-A beta, PP2B-A gamma, PP2C alpha, PP2C alpha / beta, PP2C beta, PP2C epsilon, PP2C eta, PP2C gamma, PP2C kappa, PP2C zeta, PP2B-B1, PP2B-B2, PP2A-B55, PP2A-B55-alpha, PP2A-B55-gamma, PP2A-B56-alpha, PP2A-B56-beta, PP2A-B56-delta, PP2A-B56-gamma, PP2A-B72 and PP2A-B130.

Also see PP2 Inhibitors, PP2 Activators or PP2 Substrates for functional analysis of cellular responses to PP2.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
PP2A-Cα/β Antibody (D-3) sc-376824 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human PPP2CA 5515 5q31.1 NM_002715 P67775
176915
 


In eukaryotes, the phosphorylation and dephosphorylation of proteins on serine and threonine residues is an essential means of regulating a broad range of cellular functions, including division, homeostasis and apoptosis. A group of proteins that are intimately involved in this process are the protein phosphatases. In general, the protein phosphatase (PP) holoenzyme is a trimeric complex composed of a regulatory subunit, a variable subunit, and a catalytic subunit. Four major families of protein phosphatase catalytic subunits have been identified, designated PP1, PP2A, PP2B (calcineurin) and PP2C. An additional protein phosphatase catalytic subunit, PPX (also known as PP4) is a putative member of a novel PP family. The PP2A family comprises subfamily members PP2Aå and PP2A∫. The PP2A catalytic subunit associates with a variety of regulatory subunits. Regulatory subunits include PP2A-Aå and -A∫, PP2A-Bå and -B∫, PP2A-Cå and -C∫, and PP2A-B56å and -B56∫.

PP2A-Cα/β Antibody (D-3) Data
Click on image to enlarge
PP2A-Cα/β (D-3): sc-376824. Western blot analysis of PP2A-Cα/β expression in MCF7 (A) and T-47D (B) whole cell lysates.
PP2A-Cα/β (D-3): sc-376824. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear and cytoplasmic localization.
Download