Welcome to Santa Cruz Biotechnology!

apoA-I Antibody (G-11): sc-376811

 |  Datasheet

(Based on data analysis)

  • apoA-I Antibody (G-11) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-267 representing full length apoA-I of human origin
  • recommended for detection of apoA-I of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length apoA-I protein sequence with immunogen highlighted:
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNT

See additional Apolipoprotein Antibodies including Apolipoprotein, apoA, apoA-I, apoA-II, apoA-IV, apoA-V, apoAL, apoB, apoC-I, apoC-II, apoC-III, apoC-IV, apoD, apoE, apoF, apoH, apoL, apoL-IV, apoL-IXa, apoL-V, apoL-VI, apoL1, apoL10a, apoL11a, apoL2, apoL7a, apoL9b, apoLD1, apoM, apoN, apoO, apoOL and apoL3.

Also see Apolipoprotein Inhibitors for functional analysis of cellular responses to Apolipoprotein.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
apoA-I Antibody (G-11) sc-376811 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human APOA1 335 11q23.3 NM_000039 P02647
604091
 


Apolipoproteins are protein components of plasma lipoproteins. The human apoA-I gene encodes a single chain, 243 amino acid protein which promotes cholesterol efflux from tissues to the liver for excretion. Apolipoprotein A-I is the major protein component of high density lipoprotein (HDL) in the plasma. It can function as a cofactor for lecithin cholesterolacyltransferase (LCAT), which is responsible for the formation of most plasma cholesteryl esters. The human apoA-II gene encodes the second most abundant protein of HDL particles, where it influences plasma levels of free fatty acids (FFA). The human apoA-IV gene encodes a 396 amino acid preprotein, which after proteolytic processing is secreted from the intestine in association with chylomicron particles. ApoA-IV is a potent activator of LCAT in vitro. The human apoA-V gene encodes a 366 amino acid protein that is believed to be an important determinant of plasma triglyceride levels.

apoA-I Antibody (G-11) Data
Click on image to enlarge
apoA-I (G-11): sc-376811. Western blot analysis of apoA-I expression in human plasma whole cell lysate.
apoA-I (G-11): sc-376811. Immunoperoxidase staining of formalin fixed, paraffin-embedded human kidney tissue showing extracellular staining of glomerulus cells and cytoplasmic staining of cells in tubules.
Download