Welcome to Santa Cruz Biotechnology!

TRB-2 Antibody (F-5): sc-376776

 |  Datasheet

(Based on data analysis)

  • TRB-2 Antibody (F-5) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 11-63 mapping near the N-terminus of TRB-2 of human origin
  • recommended for detection of TRB-2 of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Full-length TRB-2 protein sequence with immunogen highlighted:
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

See additional TRB Antibodies including TRB-3, TRB-2, TRB-1 and TRB.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
TRB-2 Antibody (F-5) sc-376776 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Mouse Trib2 217410 12 A1.1 NM_144551 Q8K4K3
N/A
 


TRB-2 (Tribbles homolog 2), also known as TRIB2, C5FW or GS3955, is a cytoplasmic pro-apoptotic protein that belongs to the Tribbles subfamily of the Serine/Threonine protein kinase family. Members of the Tribbles subfamily, namely TRB-1, TRB-2 and TRB-3, contain a protein kinase-like or TRB domain that lacks the active site lysine and does not appear to display kinase activity. TRB proteins are induced by mitogens and interact with and are stabilized by MAPKKs. TRB proteins play an important function in the MAP kinase pathway, as is demonstrated by the inhibition of MAPK signaling in response to both over and underexpression of TRB proteins. TRB-1 is widely expressed with highest levels found in bone marrow, pancreas, skeletal muscle, peripheral blood leukocytes and thyroid gland; TRB-2 is predominantly expressed in peripheral blood leukocytes; and TRB-3 is found at highest levels in pancreas, bone marrow and peripheral blood leukocytes.

TRB-2 Antibody (F-5) Data
Click on image to enlarge
TRB-2 (F-5): sc-376776. Western blot analysis of TRB-2 expression in non-transfected: sc-117752 (A) and mouse TRB-2 transfected: sc-124270 (B) 293T whole cell lysates.
Download