Welcome to Santa Cruz Biotechnology!

Ral A/B Antibody (E-7): sc-374582

 |  Datasheet

(Based on data analysis)

  • Ral A/B Antibody (E-7) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 161-206 mapping at the C-terminus of Ral A of human origin
  • recommended for detection of Ral A and B of mouse, rat and human origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine, porcine and avian
 
Full-length Ral A/B protein sequence with immunogen highlighted:
MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

See additional Ral Antibodies including Ral, Ral A, Ral B and Ral BP-1.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Ral A/B Antibody (E-7) sc-374582 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human RALA 5898 7p14.1 NM_005402 P11233
179550
Human RALB 5899 2q14.2 NM_002881 P11234
179551
 


Ral A and Ral B constitute a distinct subfamily of Ras-related GTPases (i.e., GDP/GTP binding proteins) (1-3). Ral proteins are activated by a unique nucleotide exchange factor, Ral GDS, and deactivated by a distinct GTPase-activating protein (4,5). Unlike Ras proteins, Ral A and Ral B fail to induce transformed foci when activated variants are expressed in various recipient cells (1). A potential downstream target of Ral, designated Ral BP-1, has been shown to contain a Rho-GTPase-activating domain (1). This Rho-GTPase-activating domain interacts preferentially with the Rho family member Cdc42 (1). A Ras/Ral signaling pathway has been reported to mediate phospholipase D (PLD) activation by v-Src, thus indicating PLD as another downstream target of Ral A (6).

Ral A/B Antibody (E-7) Data
Click on image to enlarge
Ral A/B (E-7) : sc-374582. Immunofluorescence staining of methanol-fixed HeLa cells showing membrane localization.
Ral A/B (E-7): sc-374582. Western blot analysis of Ral A expression in non-transfected: sc-117752 (A) and human Ral A transfected: sc-115540 (B) 293T whole cell lysates.
Download