Welcome to Santa Cruz Biotechnology!

L-FABP Antibody (C-4): sc-374537

 |  Datasheet

(Based on data analysis)

  • L-FABP Antibody (C-4) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 7-126 mapping within an internal region of L-FABP of human origin
  • recommended for detection of L-FABP of mouse and human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length L-FABP protein sequence with immunogen highlighted:
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

See additional L-FABP Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
L-FABP Antibody (C-4) sc-374537 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human FABP1 2168 2p11.2 NM_001443 P07148
134650
Mouse Fabp1 14080 6 C1 NM_017399 P12710
N/A
 


Fatty acid-binding proteins, designated FABPs, are a family of homologous cytoplasmic proteins that are expressed in a highly tissue-specific manner and play an integral role in the balance between lipid and carbohydrate metabolism. FABPs mediate fatty acid (FA) and/or hydrophobic ligand uptake, transport and targeting within their respective tissues. The mechanisms underlying these actions can give rise to both passive diffusional uptake and protein-mediated transmembrane transport of FAs. FABPs are expressed in adipocytes (A-FABP), brain (B-FABP), epidermis (E-FABP, also designated psoriasis-associated FABP or PA-FABP), muscle and heart (H-FABP, also designated mammary-derived growth inhibitor or MDGI), intestine (I-FABP), liver (L-FABP), myelin (M-FABP) and testis (T-FABP). Liver-specific FABP (L-FABP) expression is modulated by developmental, hormonal, dietary and pharmacological factors and is required for cholesterol synthesis and metabolism.

L-FABP Antibody (C-4) Data
Click on image to enlarge
L-FABP (C-4): sc-374537. Western blot analysis of L-FABP expression in non-transfected: sc-117752 (A) and mouse L-FABP transfected: sc-121261 (B) 293T whole cell lysates.
L-FABP (C-4): sc-374537. Immunoperoxidase staining of formalin fixed, paraffin-embedded human colon tissue showing cytoplasmic staining of glandular and interstitial cells.
Download