Menin Antibody (B-9) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

Menin Antibody (B-9): sc-374371	\| Datasheet

5 5 (Based on data analysis) 1

Menin Antibody (B-9) is a mouse monoclonal IgG₁ provided at 200 µg/ml
raised against amino acids 1-300 of Menin of human origin
recommended for detection of Menin of human origin by WB, IP, IF, IHC(P) and ELISA

Full-length Menin protein sequence with immunogen highlighted:

MGLKAAQKTLFPLRSIDDVVRLFAAELGRE See more...

MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVEALQAWADTATVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL

See additional Menin Antibodies.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF IHC(P)

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	MEN1	4221	11q13.1	NM_000244, NM_130799, NM_130800, NM_130801, NM_130802, NM_130803, NM_130804	O00255	145000
Mouse	Men1	17283	19 A	NM_001168488, NM_001168489, NM_001168490, NM_008583	O88559	N/A

Menin (multiple endocrine neoplasia I, MEN1, MEAI, SCG2) is a nuclear tumor suppressor that is mutated in patients with multiple endocrine neoplasia type I (MEN1). Menin can activate the transcription of differentiation-regulating genes by covalent histone modification. In osteoblasts, the interaction of menin and the TGF∫eta/Smad3 pathway negatively regulates BMP2/Smad1/5- and Runx2-dependent transcription activities leading to inhibition of late-stage differentiation. Menin regulates the expression of IGFBP-2 by influencing the IGFBP-2 promoter. Ectopic overexpression of menin via adenoviruses induces apoptosis in murine embryonic fibroblasts in a Bax/Bak-dependent manner. Two mRNA exist and two variants of the shorter mRNA have alternative splicing that changes the CDS. Five variants where alternative splicing takes place in the 5' UTR have been identified.

Menin Antibody (B-9) Data

Click on image to enlarge

Menin (B-9): sc-374371. Western blot analysis of Menin expression in K-562 (A) and Jurkat (B) nuclear extracts.

Menin (B-9): sc-374371. Immunoperoxidase staining of formalin fixed, paraffin-embedded human testis tissue showing nuclear staining of cells in seminiferous ducts and Leydig cells.

Download

Datasheets

Get Adobe Acrobat Reader

Menin Antibody (B-9): sc-374371