Welcome to Santa Cruz Biotechnology!

ITM2B Antibody (C-8): sc-374362

 |  Datasheet

(Based on data analysis)

  • ITM2B Antibody (C-8) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-54 mapping at the N-terminus of ITM2B of human origin
  • recommended for detection of ITM2B (Integral membrane protein 2B) of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length ITM2B protein sequence with immunogen highlighted:
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

See additional ITM2 Antibodies including ITM2, ITM2C, ITM2A and ITM2B.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
ITM2B Antibody (C-8) sc-374362 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ITM2B 9445 13q14.2 NM_021999 Q9Y287
603904
Mouse Itm2b 16432 14 D3 NM_008410 O89051
N/A
 


The type II integral membrane (ITM2) protein family consists of three members: ITM2A (also designated E25), ITM2B and ITM2C. ITM2A expression is high in osteogenic and lymphoid tissues, while both ITM2B and ITM2C are expressed in brain. ITM2B is a 266 amino acid protein that contains a potential N-glycosylation site, a potential single transmembrane-spanning domain between amino acids 52 and 74 and an extracellular C-terminal domain. Mutations in the ITM2B gene can lead to familial British dementia (FBD), and autosomal dominant disease with an onset around the fifth decade of life that is characterized by progressive dementia, spasticity and cerebellar ataxia. Familial Danish dementia (FDD), also designated heredopathia ophthalmo-oto-encephalica, is also associated with mutations in the ITM2B gene. FDD is an autosomal dominant disorder characterized by cataracts, deafness, progressive ataxia and dementia.

ITM2B Antibody (C-8) Data
Click on image to enlarge
ITM2B (C-8): sc-374362. Western blot analysis of ITM2B expression in non-transfected: sc-110760 (A) and human ITM2B transfected: sc-112200 (B) 293 whole cell lysates.
ITM2B (C-8): sc-374362. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic vesicles localization.
ITM2B (C-8): sc-374362. Immunoperoxidase staining of formalin fixed, paraffin-embedded human duodenum tissue showing cytoplasmic staining of glandular cells.
Download