Welcome to Santa Cruz Biotechnology!

CA XII Antibody (A-3): sc-374313

 |  Datasheet

(Based on data analysis)

  • CA XII Antibody (A-3) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 241-354 of CA XII of human origin
  • recommended for detection of CA XII of human origin by WB, IP, IF and ELISA
 
Full-length CA XII protein sequence with immunogen highlighted:
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA

See additional Carbonic Anhydrases Antibodies including Carbonic Anhydrases, CA I, CA II, CA III, CA IV, CA IX, CA V, CA VB, CA VI, CA VII, CA VIII, CA X, CA XI, CA XII, CA XIII, CA XIV and CA XV.

Also see Carbonic Anhydrases Inhibitors for functional analysis of cellular responses to Carbonic Anhydrases.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
CA XII Antibody (A-3) sc-374313 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CA12 771 15q22.2 NM_001218, NM_206925 O43570
603263
Mouse Car12 76459 9 C NM_178396 Q8CI85
N/A
 


Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. CAs are involved in a variety of biological processes including respiration, calcification, acid-base balance and bone resorption, as well as the formation of aqueous humor, cerebrospinal fluid, saliva and gastric juice. They show extensive diversity in distribution and in their subcellular localization. The human CA2 gene, which maps to chromosome 8q21, encodes CA II, a cytoplasmic protein that has the highest turnover rate and widest tissue distribution of any known human CA isozyme. The human CA4 gene, which maps to chromosome 17q23, encodes CA IV, a membrane-anchored isozyme that is expressed on the luminal surfaces of pulmonary capillaries and proximal renal tubules. The human CA9, CA12 and CA14 genes, which map to chromosomes 9p13, 15q22 and 1q21, respectively, encode transmembrane proteins that have unique patterns of tissue-specific expression. CA IX is specifically expressed in clear-cell renal carcinomas, whereas CA XII is highly expressed in normal tissues, such as kidney, colon and pancreas. Human CA XIV is also expressed in normal tissues, such as brain, but differs from CA XII in its expression pattern.

CA XII Antibody (A-3) Data
Click on image to enlarge
CA XII (A-3): sc-374313. Western blot analysis of CA XII expression in MCF7 whole cell lysate.
Download