Welcome to Santa Cruz Biotechnology!

HNMT Antibody (D-5): sc-374306

 |  Datasheet

(Based on data analysis)

  • HNMT Antibody (D-5) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-292 representing full length HNMT of human origin
  • recommended for detection of HNMT of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length HNMT protein sequence with immunogen highlighted:
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIE

See additional HNMT Antibodies.

Also see HNMT Inhibitors for functional analysis of cellular responses to HNMT.


Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
HNMT Antibody (D-5) sc-374306 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human HNMT 3176 2q22.1 NM_001024074, NM_001024075, NM_006895 P50135
605238
Mouse Hnmt 140483 2 A3 NM_080462 Q91VF2
N/A
 


Histamine is a biogenic amine that functions as a neurotransmitter in the gut and plays an important role in the immune system, specifically by dilating blood vessels in response to allergic reactions. HNMT (Histamine N-methyltransferase), also known as HMT, HNMT-S1 or HNMT-S2, is a 292 amino acid protein that exists as a monomer and belongs to the methyltransferase superfamily. Localized to the cytoplasm, HNMT catalytically inactivates histamine by N-methylation and, via this inactivation, plays an essential role in the degradation of histamine. Through its ability to regulate and reduce the amount of histamine within the cell, HNMT participates in the airway response and limits the severity of allergic reactions. A common genetic polymorphism in HNMT may be linked to a predisposition to asthma. HNMT is expressed as multiple isoforms due to alternative splicing events.

HNMT Antibody (D-5) Data
Click on image to enlarge
HNMT (D-5): sc-374306. Western blot analysis of HNMT expression in Hep G2 whole cell lysate.
HNMT (D-5): sc-374306. Immunofluorescence staining of methanol-fixed HeLa cells showing cytoplasmic localization.
HNMT (D-5): sc-374306. Immunoperoxidase staining of formalin fixed, paraffin-embedded human duodenum tissue showing cytoplasmic staining of glandular cells.
Download