Welcome to Santa Cruz Biotechnology!

TTP Antibody (A-8): sc-374305

 |  Datasheet

(Based on data analysis)

  • TTP Antibody (A-8) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 166-285 mapping near the C-terminus of TTP of human origin
  • recommended for detection of TTP of human origin by WB, IP, IF, IHC(P) and ELISA
 
Full-length TTP protein sequence with immunogen highlighted:
MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE

See additional TTP Antibodies including TTP, alpha-TTP and TTP-alpha L.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
TTP Antibody (A-8) sc-374305 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human ZFP36 7538 19q13.31 NM_003407 P26651
190700
Mouse Zfp36 22695 7 A3 NM_011756 P22893
N/A
 


Tristetraprolin (TTP), also known as Nup475 and TIS11, is a zinc-binding protein encoded by the immediate-early response gene, Zfp-36 (1,2). Stimulation of quiescent fibroblasts by mitogens, including platelet derived growth factor and fibroblast growth factor, results in the serine phosphorylation of TTP and the rapid redistribution of the protein from the nucleus to the cytoplasm (3). In vitro studies have demonstrated that TTP is phosphorylated by p42 MAP kinase, indicating that the activity of TTP may be regulated by the MAP kinase pathway in vivo (4). Knockout mice deficient in TTP develop autoimmunity, inflammatory arthritis and dermatitis (5). These conditions can be reversed by blocking the activity of the inflammatory mediator, tumor necrosis factor-alpha (TNF-å), suggesting that TTP may function to negatively regulate the expression of TNF-a (6).

TTP Antibody (A-8) Data
Click on image to enlarge
TTP (A-8): sc-374305. Western blot analysis of TTP expression in non-transfected: sc-117752 (A) and human TTP transfected: sc-178098 (B) 293T whole cell lysates.
TTP (A-8): sc-374305. Immunoperoxidase staining of formalin fixed, paraffin-embedded human cervix tissue showing cytoplasmic staining of squamous epithelial cells.
Download