MREG Antibody (F-3) | Santa Cruz Biotech

Welcome to Santa Cruz Biotechnology!

Research Products
Primary Antibodies: Mammalian Phospho-Specific Antibodies Antibodies for IHC (Paraffin) Staining Flow Cytometry Veterinary Research Antibodies Primary Antibodies: Non-Mammalian siRNA and shRNA (plasmid and lentivirus) Products Protein A, G PLUS and L-Agarose Tissue Extracts and Cell Lysates Biologically Active and Purified Proteins Transfected Cell Lysates Secondary Antibodies, Control Antibodies and Normal Sera Specialty Reagents and Kits
Chemicals
Biochemicals Prepared Buffers Buffer Components and Standard Lab Chemicals Stains Dyes and Fluorescent Probes Solvents HRP and AP Substrates
Lab Supplies
Animal Health
Animal Health Promo Animal Health Book Promo Animal Health News Animal Health Pharmacy Ultra Cruz Supplements
What's New
Promotionals LIF Protein Veterinary Research Antibodies Monoclonal Antibodies New IHC (Paraffin) Staining
Information
Contact Us Order Information Cruz Credits™ Investigator Awards Job Opportunities Distributors
Support
Protocols Product Citations Datasheets / MSDS Technical Service Catalog Request Chromosome DBase

MREG Antibody (F-3): sc-374216	\| Datasheet

5 5 (Based on data analysis) 1

MREG Antibody (F-3) is a mouse monoclonal IgG_2b provided at 200 µg/ml
raised against amino acids 1-214 representing full length MREG of human origin
recommended for detection of MREG of human origin by WB, IP, IF and ELISA

Full-length MREG protein sequence with immunogen highlighted:

MGLRDWLRTVCCCCGCECLEERALPEKEPL See more...

MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPS

See additional MREG Antibodies.

Ordering InformationGene Info

Recommended Support Products:

(click button of application of choice)

WB IP IF

Species	Gene Name	Gene ID	Chromosome Location	Isoform (mRNA) Accession #	Protein Accession #	OMIM™ Number

Human	MREG	55686	2q35	NM_018000	Q8N565	609207
Mouse	Mreg	381269	1 C3	NM_001005423	Q6NVG5	N/A

The photoreceptor rod cell that is responsible for vision under conditions of low light consists of stacked arrays of disk membranes that make up its outer segment portion. Regulated by complex biochemical mechanisms, the rod outer segment is under constant renewal as new disks form at the base. MREG (melanoregulin), also known as DSU (dilute suppressor protein homolog) or WDT2, is thought to play a role in membrane fusion and in regulating the biogenesis of disk membranes of photoreceptor rods. MREG interacts with RDS (also known as Peripherin-2), a photoreceptor specific tetraspanin protein that is required to maintain normal cell structure during the renewal process of membrane fusion. MREG is 214 amino acids in length, is expressed in photoreceptor cells and and is expressed as two isoforms due to alternative splicing.

MREG Antibody (F-3) Data

Click on image to enlarge

MREG (F-3): sc-374216. Immunofluorescence staining of methanol-fixed HeLa cells showing membrane localization.

MREG (F-3): sc-374216. Western blot analysis of MREG expression in non-transfected 293T: sc-117752 (A), human MREG transfected 293T: sc-115293 (B) and MCF7 (C) whole cell lysates.

MREG (F-3): sc-374216. Western blot analysis of MREG expression in non-transfected 293T: sc-117752 (A), human MREG transfected 293T: sc-371309 (B), MCF7 (C), CCRF-CEM (D) and DU 145 (E) whole cell lysates.

Download

Datasheets

Get Adobe Acrobat Reader

MREG Antibody (F-3): sc-374216