Welcome to Santa Cruz Biotechnology!

DAZAP1 Antibody (C-1): sc-374145

 |  Datasheet

(Based on data analysis)

  • DAZAP1 Antibody (C-1) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 161-247 mapping within an internal region of DAZAP1 of human origin
  • recommended for detection of DAZAP1 of human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, bovine and porcine
 
Full-length DAZAP1 protein sequence with immunogen highlighted:
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR

See additional DAZAP Antibodies including DAZAP, DAZAP1 and DAZAP2.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
DAZAP1 Antibody (C-1) sc-374145 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human DAZAP1 26528 19p13.3 NM_018959, NM_170711 Q96EP5
607430
Mouse Dazap1 70248 10 C1 NM_001122604, NM_001122605, NM_133188 Q9JII5
N/A
 


DAZAP1 (deleted in azoospermia-associated protein 1) is a 407 amino acid RNA-binding protein that interacts with DAZ (deleted in azoospermia), a gene with multiple protein products that are deleted in infertile men. Localized to the nucleus of round spermatids and to the cytoplasm of elongated spermatids, DAZAP1 contains two RNP motifs and is thought to be essential for normal spermatogenesis. Binding of DAZAP1 to DAZ mRNA induces translation of DAZ proteins that are required for germ cell development. When DAZAP1 is phosphorylated, it dissociates from DAZ mRNA and prevents proper protein translation, thereby regulating the expression of DAZ proteins. Additionally, DAZAP1 can fuse to the DNA-binding protein MEF-2D; a fusion that disrupts proper signaling pathways and may, therefore, be involved in leukemogenesis. DAZAP1 is expressed predominately in the testis, with weak expression observed in the thymus, heart, liver, brain and pancreas. Two isoforms of DAZAP1 exist due to alternative splicing events.

DAZAP1 Antibody (C-1) Data
Click on image to enlarge
DAZAP1 (C-1): sc-374145. Western blot analysis of DAZAP1 expression in Jurkat nuclear extract.
DAZAP1 (C-1): sc-374145. Immunoperoxidase staining of formalin fixed, paraffin-embedded human urinary bladder tissue showing nuclear staining of urothelial cells.
DAZAP1 (C-1): sc-374145. Western blot analysis of DAZAP1 expression in HeLa (A) and IMR-32 (B) nuclear extracts.
Download