Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transcription Regulators » Small Nuclear Ribonucleoprotein-Associated Protein Antibodies » Sm B/B'/N Antibody (H-9): sc-374078

Sm B/B'/N Antibody (H-9): sc-374078

 |  Datasheet

(Based on data analysis)

  • Sm B/B'/N Antibody (H-9) is a mouse monoclonal IgG2b provided at 200 µg/ml
  • raised against amino acids 1-240 representing full length SmB of human origin
  • recommended for detection of Sm B, Sm B’ and Sm N of human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine and canine
 
Full-length Sm B/B'/N protein sequence with immunogen highlighted:
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPR

See additional Small Nuclear Ribonucleoprotein-Associated Protein Antibodies including Small Nuclear Ribonucleoprotein-Associated Protein, Sm B/B'/N, Sm D1, Sm E, Sm F, Sm G, Sm D2 and Sm D3.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Sm B/B'/N Antibody (H-9) sc-374078 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human SNRPB 6628 20p13 NM_003091, NM_198216 P14678
 182282
Human SNRPN 6638 15q11.2 NM_003097, NM_022805, NM_022806, NM_022807, NM_022808 P63162
 182279
Mouse Snrpb 20638 2 F1 NM_009225 P27048
 N/A
Mouse Snrpn 20646 7 C NM_001082961, NM_001082962, NM_013670 P63163
 N/A
 

mRNA precursors are processed in the spliceosome, where introns are excised to form continuous coding sequences. The major components of the spliceosome are RNA-protein complexes called snRNPs (small nuclear ribonucleoprotein particles) (1). The core proteins that are common to all snRNPs are called the Sm proteins, and are designated B, B’, D1, D2, D3, E, F and G (2). Antibodies recognizing Sm proteins are frequently generated in autoimmune diseases, including in patients with systemic lupus erythematosus (3). Sm proteins are characterized by a conserved Sm sequence motif in two parts, Sm1 and Sm2, which are separated by a variable region (4, 5).

Sm B/B'/N Antibody (H-9) Data
Click on image to enlarge
sc-374078
Sm B/B'/N (H-9): sc-374078. Western blot analysis of Sm B/B'/N expression in K-562 (A), HeLa (B) and KNRK (C) nuclear extracts.
sc-374078
Sm B/B'/N (H-9): sc-374078. Immunofluorescence staining of methanol-fixed HeLa cells showing nuclear localization.
sc-374078
Sm B/B'/N (H-9): sc-374078. Immunoperoxidase staining of formalin fixed, paraffin-embedded human brain tissue showing nuclear staining of neuronal cells.
Download
Datasheets
Get Adobe Acrobat Reader