Welcome to Santa Cruz Biotechnology!

HBXIP Antibody (H-5): sc-373980

 |  Datasheet

(Based on data analysis)

  • HBXIP Antibody (H-5) is a mouse monoclonal IgG2a provided at 200 µg/ml
  • raised against amino acids 1-91 representing full length HBXIP of human origin
  • recommended for detection of HBX-interacting protein of human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, bovine and porcine
 
Full-length HBXIP protein sequence with immunogen highlighted:
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMA

See additional HBXIP Antibodies.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
HBXIP Antibody (H-5) sc-373980 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human HBXIP 10542 1p13.3 NM_006402 O43504
608521
Mouse Hbxip 68576 3 F2.3 NM_026774 Q9D1L9
N/A
 


HBXIP (hepatitis B virus X-interacting protein), also known as HBV X-interacting protein or HBX-interacting protein, was originally identified by its ability to form a complex with the C-terminus of hepatitis B virus X (HBX) protein. HBXIP negatively regulates the activity of HBX and alters the replicative life cycle of the virus. HBXIP is an evolutionarily conserved protein. It contains a leucine zipper motif and two consensus phosphorylation sites. HBXIP also forms complexes with survivin (an overexpressed protein in most human cancers) and is necessary for allowing survivin to bind and inhibit the activation of pro-caspase-9, suggesting that HBXIP acts as an anti-apoptotic cofactor of survivin. In addition, HBXIP is involved in bipolar spindle formation and regulates centrosome dynamics and cytokinesis in cells, possibly through an interaction with Dynein light chain. The overexpression of HBXIP promotes proliferation in a variety of cells lines.

HBXIP Antibody (H-5) Data
Click on image to enlarge
HBXIP (H-5): sc-373980. Western blot analysis of HBXIP expression in non-transfected: sc-117752 (A) and human HBXIP transfected: sc-116745 (B) 293T whole cell lysates.
HBXIP (H-5): sc-373980. Immunoperoxidase staining of formalin fixed, paraffin-embedded human bone marrow tissue showing nuclear staining of hematopoietic cells.
Download