Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Neurobiology » Complexin Antibodies » Complexin-3 Antibody (A-9): sc-365942

Complexin-3 Antibody (A-9): sc-365942

 |  Datasheet

(Based on data analysis)

  • Complexin-3 Antibody (A-9) is a mouse monoclonal IgG1 provided at 200 µg/ml
  • raised against amino acids 1-44 mapping at the N-terminus of Complexin-3 of human origin
  • recommended for detection of Complexin-3 of m and h origin by WB, IP, IF and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
 
Full-length Complexin-3 protein sequence with immunogen highlighted:
MAFMVKTMVGGQLKNLTGSLGGGEDKGDGDKSAAEAQGMSREEEEYQKQLVEEKMERDAQFTQRKAERATLRSHFRDKYRLPKNETDESQIQMAGGDVELPRELAKMIEEDTEEEEEKASVLGQLASLPGLNLGSLKDKAQATLGDLKQSAEKCHVM

See additional Complexin Antibodies including Complexin-3, Complexin-2, Complexin-1, Complexin and Complexin-4.

Ordering InformationGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
Complexin-3 Antibody (A-9) sc-365942 200 µg/ml $279
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CPLX3 594855 15q24.1 NM_001030005 Q8WVH0
 609585
Mouse Cplx3 235415 9 B NM_146223 Q8R1B5
 N/A
 

Members of the Complexin protein family promote SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) precomplex formation by binding to Syntaxin via an å-helical domain. Complexins are important regulators of transmitter release at a late step in calcium-dependent neurotransmitter release or immediately after the calcium-triggering step of fast synchronous transmitter release. Neurons lacking Complexins show reduced transmitter release efficiency due to decreased calcium sensitivity of the synaptic secretion process. Complexin-3, also known as CPXIII, CPX-III, Nbla11589 or CPLX3, is a 158 amino acid member of the complexin/synaphin family. Complexin-3 is involved in the regulation of synaptic vesicle exocytosis. Complexin-3 binds to the SNARE core complex containing SNAP 25, VAMP-2 and Syntaxin 1.

Complexin-3 Antibody (A-9) Data
Click on image to enlarge
sc-365942
Complexin-3 (A-9): sc-365942. Western blot analysis of Complexin-3 expression in non-transfected: sc-117752 (A) and mouse Complexin-3 transfected: sc-119381 (B) 293T whole cell lysates.
Download
Datasheets
Get Adobe Acrobat Reader