Welcome to Santa Cruz Biotechnology!
SCBT Home
Home » Transcription Regulators » Barrier to Autointegration Factor Antibodies » BAF Antibody (FL-89): sc-33787

BAF Antibody (FL-89): sc-33787

 |  Datasheet

(Based on data analysis)

  • BAF Antibody (FL-89) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-89 representing full length barrier-to-autointegration factor of human origin
  • recommended for detection of barrier-to-autointegration factor of mouse, rat and human origin by WB, IP, IF, IHC(P) and ELISA; also reactive with additional species, including equine, canine, bovine and porcine
  • TransCruz reagent for Gel Supershift and ChIP applications, sc-33787 X, 200 µg/0.1 ml
  • See 1 citations for BAF Antibody (FL-89)
 
Full-length BAF protein sequence with immunogen highlighted:
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF

See additional Barrier to Autointegration Factor Antibodies.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   IHC(P)   Gel Shift   ChIP   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
BAF Antibody (FL-89) sc-33787 200 µg/ml $279
BAF Antibody (FL-89) X sc-33787 X 200 µg/0.1 ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BAF siRNA (h) sc-43627 10 µM $258
BAF siRNA (m) sc-44804 10 µM $258
BAF (h)-PR sc-43627-PR 10 µM, 20 µl $23
BAF siRNA (m)-PR sc-44804-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BAF shRNA Plasmid (h) sc-43627-SH 20 µg $520
BAF shRNA Plasmid (m) sc-44804-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
BAF shRNA (h) Lentiviral Particles sc-43627-V 200 µl $625
BAF siRNA shRNA (m) Lentiviral Particles sc-44804-V 200 µl $625
 WB Positive Control Cell Lysates (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
Jurkat Whole Cell Lysate sc-2204 500 µg/200 µl $104
HeLa nuclear extract sc-2120 250 µg/0.05 ml $143
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human BANF1 8815 11q13.1 NM_003860 O75531
 603811
Mouse Banf1 23825 19 A O54962
 N/A
 

Barrier-to-autointegration factor (BAF) binds non-specifically to double stranded DNA, possibly to play a role in tissue- or cell type-specific gene expression by interacting with different homeodomain transcription factors. BAF compresses chromatin structure and interacts with the LEM domain of nuclear proteins to play a crucial role in membrane recruitment and chromatin decondensation during nuclear assembly. Additionally, retroviruses like HIV-1 incorporate BAF from host cells into preintegration complexes (PICs) to prevent autointegration of retroviral DNA and thereby promote integration of retroviral DNA into the host chromosome.

BAF Antibody (FL-89) Product Citations
See how others have used BAF Antibody (FL-89) and or BAF Antibody (FL-89) conjugates.


1 total citations
Loading citations.
 
BAF Antibody (FL-89) Data
Click on image to enlarge
sc-33787
BAF (FL-89): sc-33787. Western blot analysis of BAF expression in HeLa nuclear extract.
sc-33787
BAF (FL-89): sc-33787. Immunoperoxidase staining of formalin fixed, paraffin-embedded human ovary tissue showing nuclear staining of stromal cells in low (A) and high (B) resolution. Kindly provided by The Swedish Human Protein Atlas (HPA) program.
sc-33787
BAF (FL-89): sc-33787. Immunoperoxidase staining of formalin fixed, paraffin-embedded human thyroid gland tissue showing nuclear and cytoplasmic staining of glandular cells.
Download
Datasheets
Get Adobe Acrobat Reader