Welcome to Santa Cruz Biotechnology!

MIP-1α Antibody (FL-92): sc-33203

 |  Datasheet

(Based on data analysis)

  • MIP-1α Antibody (FL-92) is a rabbit polyclonal IgG provided at 200 µg/ml
  • epitope corresponding to amino acids 1-92 representing full length MIP-1α of human origin
  • recommended for detection of MIP-1α and LD78β and, to a lesser extent, MIP-1β and MIP-4 of mouse, rat and human origin by WB, IP, IF and ELISA
  • See 1 citations for MIP-1α Antibody (FL-92)
 
Full-length MIP-1α protein sequence with immunogen highlighted:
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELS

See additional MIP Antibodies including MIP, MIP-1 alpha, MIP-1 beta, MIP-1 gamma, MIP-2, MIP-3 alpha, MIP-3 beta, MIP-4 and MIP-5.

Ordering InformationProduct CitationsGene Info
Recommended Support Products:
(click button of application of choice)
WB   IP   IF   siRNA  
Set Currency

 Ordering Information
Product NameCatalog #UnitPriceQtyAdd 
MIP-1α Antibody (FL-92) sc-33203 200 µg/ml $279
 siRNA Gene Silencers (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MIP-1α siRNA (h) sc-43933 10 µM $258
MIP-1α siRNA (m) sc-44722 10 µM $258
MIP-1α (h)-PR sc-43933-PR 10 µM, 20 µl $23
MIP-1α siRNA (m)-PR sc-44722-PR 10 µM, 20 µl $23
 shRNA Plasmids (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MIP-1α shRNA Plasmid (h) sc-43933-SH 20 µg $520
MIP-1α shRNA Plasmid (m) sc-44722-SH 20 µg $520
 shRNA Lentiviral Particles (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MIP-1α shRNA (h) Lentiviral Particles sc-43933-V 200 µl $625
MIP-1α siRNA shRNA (m) Lentiviral Particles sc-44722-V 200 µl $625
 WB Positive Control Cell Lysate (click product name for more information)
Product NameCatalog #UnitPriceQtyAdd 
MIP-1α (h): 293T Lysate sc-114143 100 µg/200 µl $205
 
Species Gene Name Gene ID Chromosome Location Isoform (mRNA) Accession # Protein Accession # OMIM™ Number
Human CCL3 6348 17q12 NM_002983 P10147
609423
Mouse Ccl3 20302 11 C P10855
N/A
 


Chemokines are members of a superfamily of small inducible, secreted, pro-inflammatory cytokines. Members of the chemokine family exhibit 20 to 50% homology in their predicted amino acid sequences and are divided into four subfamilies. In C-C (or b) subfamily, the first two cysteines are adjacent. C-C chemokines are chemoattractants and activators for monocytes and T cells. C-C subfamily members include macrophage inflammatory protein (MIP)-1å, MIP-1∫, MIP-2, MIP-3å, MIP-3∫, MIP-4, HCC-1, MIP-5 (or HCC-2), RANTES, MCP-1/2/3 (and the murine homologs JE and MARC), I-309, murine C10 and TCA3. Research has shown that MIP-1∫ is more selective than MIP-1å, primarily attracting CD4+ T lymphocytes, with a preference for T cells of the naive phenotype. MIP-1å is a more potent lymphocyte chemoattractant than MIP-1∫ and exhibits a broader range of chemoattractant specificities. It has been suggested that CD8+ T lymphocytes are involved in the control of HIV infection in vivo by the release of HIV-suppressive factors (HIV-SF). MIP-1å has been identified as one of the major HIV-SFs produced by CD8+ T cells, along with MIP-1∫ and RANTES. Recombinant human MIP-1å acts as an inhibitor of different strains of HIV-1, HIV-2 and SIV infection in a dose-dependent manner.

MIP-1α Antibody (FL-92) Product Citations
See how others have used MIP-1α Antibody (FL-92) and or MIP-1α Antibody (FL-92) conjugates.


1 total citations
Loading citations.
 
MIP-1α Antibody (FL-92) Data
Click on image to enlarge
MIP-1α (FL-92): sc-33203. Western blot analysis of MIP-1α expression in non-transfected: sc-117752 (A) and human MIP-1α transfected: sc-114143 (B) 293T whole cell lysates.
Download